Dataset for protein classical BH3-containing proteins of organism Accipiter nisus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hleqdgglsfpaktgdaqavisqgcsprraalspgrglgpllrlrptpgtdeesgeastrgsppglarpagvlragscgv
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
tdgspgrapagagpgraqpaparggdsrprppapqpgragpgrahlsrggggcpsrrapplpahwpaggggarrgrgrrq
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------g-----f---dggpa-q-----------
lfavrpaaaaavwrwggaaaapgtprprgtpvpllgmmdrpsyleedyssld-ldddv-pse-f-lpg-pwpgtppplpt
                                    aakq pevk   aqr mfslrlphedv-s--aslrg s ka ig
                                                     eggee  a pph   ni e a a    
                                                              g                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          .     :*.             
---------pgemtgtgif-tqnspy--l-grfqlfplthrg-----apgiphpvqqdratqtssPpv------------
spirvgppp-----a---wr---qslsc-l-ps-----egccrlgaegg-grgdepgfkgrsrla ssssqdvmlpcgvt
paaaa lglr pyh-pvv-gstt---lyfvs--splsr----yfsfd--r-----spg tlrkp   cqplshc samas
      iafg gpgsgqt  glrp  fi cr  reigpsss       e s a lmc      a   aaaag        
         d dga   p  aah       p  p gfg                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           . . :*. :.*::                        
--------------------------------------lwaevqiarqLrrisDefql-----rlslqrhqqnrnqvwwq
eeprrlfygnagyrlhvppvgfaldphlqeepqegqrearvarrygqk qcmg qwh-qvlprpkhiggappg-egg-re
                            rwqshslaedvqp iwc le    a nasyc  ----------p---i-r
                                      re  a             d rq    gf dnqag  qii lk
                                                                                

       410       420       
....:....|....:....|....:..
 :    .                    
ll--l-rlwwnarrprrptpqr-----
tflf-hnaalgmeanpnhagpapppsa
i ryitk ifret---------mgl  
  nl i  f p qt wsrgms      
                           
© 1998-2022Legal notice