Dataset for protein classical BH3-containing proteins of organism Accipiter nisus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240
                                    aakq pevk   aqr mfslrlphedv-s--aslrg s ka ig
                                                     eggee  a pph   ni e a a    

       250       260       270       280       290       300       310       320
                                                          .     :*.             
spirvgppp-----a---wr---qslsc-l-ps-----egccrlgaegg-grgdepgfkgrsrla ssssqdvmlpcgvt
paaaa lglr pyh-pvv-gstt---lyfvs--splsr----yfsfd--r-----spg tlrkp   cqplshc samas
      iafg gpgsgqt  glrp  fi cr  reigpsss       e s a lmc      a   aaaag        
         d dga   p  aah       p  p gfg                                          

       330       340       350       360       370       380       390       400
                                           . . :*. :.*::                        
eeprrlfygnagyrlhvppvgfaldphlqeepqegqrearvarrygqk qcmg qwh-qvlprpkhiggappg-egg-re
                            rwqshslaedvqp iwc le    a nasyc  ----------p---i-r
                                      re  a             d rq    gf dnqag  qii lk

       410       420       
 :    .                    
i ryitk ifret---------mgl  
  nl i  f p qt wsrgms      
© 1998-2023Legal notice