Dataset for protein classical BH3-containing proteins of organism Accipiter nisus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8B9ME52_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Accipiter nisus GN=PMAIP1 (length=53 residues).
MPGRTLRKAAPPAAPAGREVEAQCALQLRRIGDKWDLRQKILNLLTKLFFPET
>gnl|bcl2dbpro|A0A8B9MPS6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Accipiter nisus GN=BCL2L11 (length=199 residues).
MAKQPPEVKAQRDGEGGRLPPAEGPGPAAQLRPGAPAALPGSAAAAGPPPRGPPASPGPFATRSPLFIFVRRSPLLSRSS
SGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHSLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLD
NQAGNPQIIILRLLRYIIRLIWRMQTPWSRGMSRMGLSA
>gnl|bcl2dbpro|A0A8B9MY06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Accipiter nisus GN=BMF (length=390 residues).
HLEQDGGLSFPAKTGDAQAVISQGCSPRRAALSPGRGLGPLLRLRPTPGTDEESGEASTRGSPPGLARPAGVLRAGSCGV
TDGSPGRAPAGAGPGRAQPAPARGGDSRPRPPAPQPGRAGPGRAHLSRGGGGCPSRRAPPLPAHWPAGGGGARRGRGRRQ
LFAVRPAAAAAVWRWGGAAAAPGTPRPRGTPVPLLGAMDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFT
QNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDP
HLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8B9MY06_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Accipiter nisus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8B9NIC6_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Accipiter nisus GN=BAD (length=144 residues).
VGHPPNIWEGTPKPLITPPIRVGLGLGGDGGGTQVWGGAHSPYSPFREGGGEGRGRLGAEAGGGPGDVPGFRGRSRSAPP
VLWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPPRPAPPAPPP
>gnl|bcl2dbpro|A0A8B9NIC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Accipiter nisus GN=BAD (length=150 residues).
MFSLEEFPEEPGSPPASPWGGSPPPIAFDGGYHGGVTWRSLTPPLLYLCPPSSPIFPEGRGRLGAEAGGGPGDVPGFRGR
SRSAPPVLWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPPRPAPPAPPP
© 1998-2022Legal notice