Dataset for protein classical BH3-containing proteins of organism Accipiter nisus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9ME52_PMAIP1-      --------------------------------------------------
A0A8B9MY06_BMF-01       HLEQDGGLSFPAKTGDAQAVISQGCSPRRAALSPGRGLGPLLRLRPTPGT
A0A8B9NIC6_BAD-02       --------------------------------------------------
A0A8B9NIC6_BAD-01       --------------------------------------------------
A0A8B9MPS6_BCL2L11      --------------------------------------------------
A0A8B9MY06_BMF-02       --------------------------------------------------
                                                                          

A0A8B9ME52_PMAIP1-      --------------------------------------------------
A0A8B9MY06_BMF-01       DEESGEASTRGSPPGLARPAGVLRAGSCGVTDGSPGRAPAGAGPGRAQPA
A0A8B9NIC6_BAD-02       --------------------------------------------------
A0A8B9NIC6_BAD-01       --------------------------------------------------
A0A8B9MPS6_BCL2L11      --------------------------------------------------
A0A8B9MY06_BMF-02       --------------------------------------------------
                                                                          

A0A8B9ME52_PMAIP1-      --------------------------------------------------
A0A8B9MY06_BMF-01       PARGGDSRPRPPAPQPGRAGPGRAHLSRGGGGCPSRRAPPLPAHWPAGGG
A0A8B9NIC6_BAD-02       --------------------------------------------------
A0A8B9NIC6_BAD-01       --------------------------------------------------
A0A8B9MPS6_BCL2L11      --------------------------------------------------
A0A8B9MY06_BMF-02       --------------------------------------------------
                                                                          

A0A8B9ME52_PMAIP1-      --------------------------------------------------
A0A8B9MY06_BMF-01       GARRGRGRRQLFAVRPAAAAAVWRWGGAAAAPGTPRPRGTPVPLLGAMDR
A0A8B9NIC6_BAD-02       --------------------------------------------------
A0A8B9NIC6_BAD-01       --------------------------------------------------
A0A8B9MPS6_BCL2L11      ----------------------------------------------MAKQ
A0A8B9MY06_BMF-02       -----------------------------------------------MDR
                                                                          

A0A8B9ME52_PMAIP1-      --------------------------------------------------
A0A8B9MY06_BMF-01       PSYLEEDYSSLDGLDDDVFHSDDFGLAGQ--------------------P
A0A8B9NIC6_BAD-02       ----------------------VGHPP-NIWEGTPKPLITPPIRVGLGLG
A0A8B9NIC6_BAD-01       ------------MFSLEEFPEEPGSPPASPWGGSPPP---------IAFD
A0A8B9MPS6_BCL2L11      PPEVK---AQRDGEGGRLPPAEGPGPAAQLRPGAPAALPGSAAAAGPPPR
A0A8B9MY06_BMF-02       PSYLEEDYSSLDGLDDDVFHSDDFGLAGQ--------------------P
                                                                          

A0A8B9ME52_PMAIP1-      ---------------------------------------------MPGRT
A0A8B9MY06_BMF-01       GEMTATGIF-TQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQDKA
A0A8B9NIC6_BAD-02       GDGGGTQVWGGAHSPY----SPFREGGGEGRGRLGAEAGGGPGDVPGFRG
A0A8B9NIC6_BAD-01       GGYHGGVTWRSLTPPLLYLCPPSSPIFPEGRGRLGAEAGGGPGDVPGFRG
A0A8B9MPS6_BCL2L11      GPPASPGPF-ATRSPLFIFVRRSPLLSRSSSGYFSFDAERSPAPLSCDKA
A0A8B9MY06_BMF-02       GEMTATGIF-TQNQSYSCLLGRFQLFPLTHCC-----GPGIRHPEQQDKA
                                                                        . 

A0A8B9ME52_PMAIP1-      LRKAAPPAAPAG--------------------------------------
A0A8B9MY06_BMF-01       TQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQE
A0A8B9NIC6_BAD-02       RSRSAPPV------------------------------------------
A0A8B9NIC6_BAD-01       RSRSAPPV------------------------------------------
A0A8B9MPS6_BCL2L11      TQTPSPPCQALSHCLSAMAS----------------------------RW
A0A8B9MY06_BMF-02       TQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQE
                            :*.                                           

A0A8B9ME52_PMAIP1-      --------REVEAQCALQLRRIGDKWDLRQ-------------------K
A0A8B9MY06_BMF-01       EPQEGQREARAEVQIARKLQCIADQFH------RLHIQRHQQNRNQVWWQ
A0A8B9NIC6_BAD-02       --------LWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRE
A0A8B9NIC6_BAD-01       --------LWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRE
A0A8B9MPS6_BCL2L11      QSHSLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILR
A0A8B9MY06_BMF-02       EPQEGQREARAEVQIARKLQCIADQFH------RLHIQRHQQNRNQVWWQ
                                     . . :*. :.*::                        

A0A8B9ME52_PMAIP1-      ILNLLTKLFFPET--------------
A0A8B9MY06_BMF-01       LFLFLHNLALNAEANRNHTGQR-----
A0A8B9NIC6_BAD-02       TL----RAWWGARRPPRPAPPAPPP--
A0A8B9NIC6_BAD-01       TL----RAWWGARRPPRPAPPAPPP--
A0A8B9MPS6_BCL2L11      LLRYIIRLIWRMQTPWSRGMSRMGLSA
A0A8B9MY06_BMF-02       LFLFLHNLALNAEANRNHTGQR-----
                         :    .                    

© 1998-2022Legal notice