Dataset for protein Bad of organism Accipiter nisus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           * ** . * *:* *         :.:.*.  *  .* .  .*     .*      **************
----------vGsPP-spWgGtPpP---------lglgGgyhGtvvWrsltsPy----sPsspigpEGRGRLGAEAGGGP
mfsleefpeep h  ani e s k litppirvgiafd dgg gqt ggahp llylcp fregfg              

        90       100       110       120       130       140       150         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
*******************************************************************************
GDVPGFRGRSRSAPPVLWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPPRPAPPAPPP
                                                                               
© 1998-2022Legal notice