Dataset for protein Bad of organism Accipiter nisus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9NIC6_BAD-02      ----------VGHPP-NIWEGTPKPLITPPIRVGLGLGGDGGGTQVWGGA
A0A8B9NIC6_BAD-01      MFSLEEFPEEPGSPPASPWGGSPPP---------IAFDGGYHGGVTWRSL
                                  * ** . * *:* *         :.:.*.  *  .* . 

A0A8B9NIC6_BAD-02      HSPY----SPFREGGGEGRGRLGAEAGGGPGDVPGFRGRSRSAPPVLWAA
A0A8B9NIC6_BAD-01      TPPLLYLCPPSSPIFPEGRGRLGAEAGGGPGDVPGFRGRSRSAPPVLWAA
                        .*     .*      **********************************

A0A8B9NIC6_BAD-02      RRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPP
A0A8B9NIC6_BAD-01      RRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPP
                       **************************************************

A0A8B9NIC6_BAD-02      RPAPPAPPP
A0A8B9NIC6_BAD-01      RPAPPAPPP
                       *********

© 1998-2022Legal notice