Dataset for protein Bad of organism Accipiter nisus

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9NIC6_BAD-01      MFSLEEFPEEPGSPPASPWGGSPPPIAF--------DGGYHGG-VTWRSL
A0A8B9NIC6_BAD-02      ----------VGHPP-NIWEGTPKPLITPPIRVGLGLGGDGGGTQVWGGA
                                  * ** . * *:* *:           **  **  .* . 

A0A8B9NIC6_BAD-01      TPPLLYLCPPSSPIFPEGRGRLGAEAGGGPGDVPGFRGRSRSAPPVLWAA
A0A8B9NIC6_BAD-02      HSPY----SPFREGGGEGRGRLGAEAGGGPGDVPGFRGRSRSAPPVLWAA
                        .*     .*      **********************************

A0A8B9NIC6_BAD-01      RRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPP
A0A8B9NIC6_BAD-02      RRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPP
                       **************************************************

A0A8B9NIC6_BAD-01      RPAPPAPPP
A0A8B9NIC6_BAD-02      RPAPPAPPP
                       *********

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice