Dataset for protein Bad of organism Accipiter nisus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9NIC6_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Accipiter nisus GN=BAD (length=144 residues).
VGHPPNIWEGTPKPLITPPIRVGLGLGGDGGGTQVWGGAHSPYSPFREGGGEGRGRLGAEAGGGPGDVPGFRGRSRSAPP
VLWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPPRPAPPAPPP
>gnl|bcl2dbpro|A0A8B9NIC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Accipiter nisus GN=BAD (length=150 residues).
MFSLEEFPEEPGSPPASPWGGSPPPIAFDGGYHGGVTWRSLTPPLLYLCPPSSPIFPEGRGRLGAEAGGGPGDVPGFRGR
SRSAPPVLWAARRYGRQLRRMSDEFQLQVLPRPKSLGGAPPGREGGWRETLRAWWGARRPPRPAPPAPPP
© 1998-2022Legal notice