Dataset for protein Bcl-xL of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A673IGS5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=239 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAAAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A673M4N6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=219 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWVGRVAGNGGVLVQSAFSLCDQGCDLIG
>gnl|bcl2dbpro|A0A673M4N6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L1 (length=239 residues).
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
KEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAVAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
© 1998-2020Legal notice