Dataset for protein Bcl-xL of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGTTTLVNGSLNGTSTGSTGTPPRSPASTPQRQ
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
                                                                                
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
***********:********************      .*. *   .   *. * .    *  *:              
KEMSPLVGSIAdWMTVYLDNKIQPWIQSQGGWerfaeifGkdAvaesrksQenFkkwllvGmtLltgvvvgsliaqkrl
           e                    ------v rv gnggvlv sa -slcdq cd ig-------------
                                           a               a                   
© 1998-2020Legal notice