Dataset for protein Bcl-xL of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673M4N6_BCL2L1-      MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGT
A0A673IGS5_BCL2L1-      MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGT
A0A673M4N6_BCL2L1-      MSYYHQELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGT
                        **************************************************

A0A673M4N6_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
A0A673IGS5_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
A0A673M4N6_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
                        **************************************************

A0A673M4N6_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
A0A673IGS5_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
A0A673M4N6_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
                        **************************************************

A0A673M4N6_BCL2L1-      GGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGW------VG
A0A673IGS5_BCL2L1-      GGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWERFAEIFG
A0A673M4N6_BCL2L1-      GGALCVECVEKEMSPLVGSIADWMTVYLDNKIQPWIQSQGGWERFAEIFG
                        *********************:********************      .*

A0A673M4N6_BCL2L1-      RVAGNGGVLVQSAF-SLCDQGCDLIG-------------
A0A673IGS5_BCL2L1-      KDAAAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQKRL
A0A673M4N6_BCL2L1-      KDAVAESRKSQENFKKWLLAGMTLLTGVVVGSLIAQKRL
                        . *   .   *. * .    *  *:              

© 1998-2020Legal notice