Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A7N4P3X2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L1 (length=235 residues).
MPEPAFLPRISEESCQADPRLREQLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAH
ETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
MEVLVARITSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A7N4P3X2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L1 (length=227 residues).
MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARI
TSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A7N4P573_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=301 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWVIAHSKYQESQRISIFLSMQ
DEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAEEIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGF
DQQGNRLGRGKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYEDK
>gnl|bcl2dbpro|A0A7N4P573_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=170 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWGVWISSSCQVLDLTNRETAW
EGGRDTMTLT
>gnl|bcl2dbpro|A0A7N4P573_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=172 residues).
MADCEFHYVHMLAQDYLKHVQQMPRLGSCLHRTSQILQKVAFSVQEEVEKDMETFLSTLDITSVDCARRIFNSVMEKEFE
DGIINWGRIVTIFAFGGILIKKLLRHRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWENGFIKNFEPNMVWPNFTDI
STKIWNVFSFLK
>gnl|bcl2dbpro|A0A7N4P573_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2A1 (length=201 residues).
MAAAAALSGFKRNLRAEMKQRLRALSAEERLRQSRLLTEKVIAHSKYQESQRISIFLSMQDEIETEEIIKDIFKQGKTCF
IPRYKFNSNYMDMVRLFSAEEIFSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGRGKGYYDTYLKR
CFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYEDK
>gnl|bcl2dbpro|A0A7N4P7T7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L10 (length=186 residues).
METEDALREETRRLVSDYLEHCCRAEGCQERAPSTPAAATMRAVAQELRRTYRDFFECAKSQLLDQPPERVIPEVAEMMD
QGGFNWGRVAVLVVFAGAMLEMEEQEKQQRGRLRSEMSRRLAEELCHYLVEKKGAWLRENGGWTGFHHHFTQKQPPPQSD
PKSTLCCIVAAAGFGLVGLALLLAVR
>gnl|bcl2dbpro|A0A7N4PQN7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL-2 (length=255 residues).
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAA
RNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNW
GRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWLSLKTLLSLA
LVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=383 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASTTTTAAAAVGLRGGSGGAN
PPDPVVPGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLP
LAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDW
LMKQKGWEMPLCDLRWSLQPSPSPVMNLLVSEYSKGSGLGVLCEQGWQYLVLVPFWLALLKVF
>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=359 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASAAVGLRGGSGGANPPDPVV
PGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLPLAREGG
DTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGM
LRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDWLMKQKG
WEGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=365 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASTTTTAAAAVGLRGGSGGAN
PPDPVVPGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLP
LAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDW
LMKQKGWEGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2022Legal notice