Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :                                             
----------------matpa-saydnrelvmdylsyklsqkgye-----------------------------------
pvtsppwpslpsplgr--h-grrgpythaiiakfvhp--r-r--awslpnlrtprspslppvvesgptvsnfsnsprstp
hsscsirffflfigsqcs-a-evshsvamaa---ighed-l-  -peaggk paalam  laragadasgiargqlpnrt
dfga  fc  fa a i  p dcmfdga d  v   k   e d  n d                         qfedeh  
                  m   e        q            d                                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  :. ..  ..      :. :   * :.    
-------------------------------vatgpgvgptppv--vhrtlrqagdeferryrrdfsdmssqLhitpv-t
ppaeptelpttvtlypswsplptryvvgattcgastaessvnepgklsqamqavafdvssnfettmdellgt dvksgds
lasagqdiesstngsgrsleaispplse agqsvmlrltkplrsaatlli  r   s qlev ka qtfaak  l ne e
e   ed daeedeaaaqnh  dp aara   hqs  kdhecihr  ake   k   g  e h    eg tr        c
                                 q  da              e                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .  *    * .*  ****:*::: **. :                        .         :: .. *      
arqrftqVveelFrdG-vNWGRiVaffvFGgalcvesvnremeplv----dsialwmteylnrhlanwiqsngGwe-f--
dqgsvat sdkv qg va    l tlis  avm-akllsknrsvctmdthgqvtsyivtvkvtskhdylrdsk aat-ve
 yri ss mthe s  it       i e   ivakhkklihqas i    erlsrsgahliqnqirr  pqqa  -ekta
 ika nr  n   e   i         a   f  i   d           apeqhf  df mkn dp  mkk   gg ai
                                                 e ke      egi  e  h   d    
                                                      d      de                 

       250       260       270       280    
....:....|....:....|....:....|....:....|....
                                            
lygvsaleearr-----wa-v--vltg---l-------------
-vhdgk-f----lregn--s-rt----ava-galvtvgaffask
fn tigp-qvsmnvllvqprftrwsltlwyvisvlll sl sr 
cm nednagsnk    gfen ngigakimt frf k        
 f fd a  pi     a  g ad    gan ag           
         g                                  
© 1998-2020Legal notice