Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlgpfkknaviglnlycggaglgagsgasaspsggrlltngkgtavesspprldggevgasttttaaaavglrggsggan
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------evadgefhyvlsleqeylkhvqqlpr---------p
ppdpvvpgvrgvarpapigaeardvtapprpfffapggrcsppa-mvvcaadakhmqagdlwgyepemngkrparlaml-
                              mphpgrlpmsysnrctemallseirrprdyndsqf-des-teasegtei 
                               ae  f   iheemaq apysrft n ks mk---e--gnl tpasps  
                                       g d s l  krrg q   va e qrlraac           
                                             i  dfie          e c               
                                             a                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------ygsslel--------a------------rasqtlrrvag-svqrey
laveggptssnargslpstpppaepdedeeedelleqcsh-itrylreq-vvtkdtkplrsgktleitqkegfdgfeerv
strnssdswgifsnqprh  l  headsravsgaaahrqs dahetipv agkqgpavspvp-----alaqtdrekyqnh
pv a a av              a q latstt t rn r ppppavaa t aa        qvvslpe aimhd sl s
                                    g  p                      psrl  a   a a a  l
                                    e                           ph              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :                       :     * . :  .  *..                       :       
erafqtmlsqlditsvedikri-ssvvtevfsdGv-NWGRivtlfsFggili---kklksirqeltvd---eiae-----
rtdmegftrtdhskpedcaravfnrgmeklmrryit snyvdaiia safvcemevhsvrhnmpslmatherlshealst
qktysdlsmkaklqngtayqsfveqeknheieq ki    mavfvv ama   feeldkeasvcipmsrpvts     
  isrf fgc e etl qrper kt  acm p  gf      mvrl   vel   es pqtswrprsegdds rl     
    ie  e     l  ipgd  ip    f d             e   e      q  nr gnihq             
    d                  a                                   kq                   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :          .:    *:                                                      
------fiaeylvnskreWirqngGW------------------------------------------------------
ggldliwmtdvimknladrlqkqk yemgfvefresqrisiflsmqdeieteeiikdifkqgktcfiprykfnsnymdmv
      slptfgdehigp  meg   diplskyq                                              
      e chl nrqqdn  gr    v ahcdl                                               
         g  fdk ha   d    g                                                     
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------y-----------py
rlfsaeeifslpktswhvhqpleggvrnvllsefagvagvgalfmqglgfdqqgnrlgrvwtfvet-gndcfqhsrrwqe
               fsl edspspimelava yskts ldvicep w           gkiyydlglkraaaeqkkraq
                ni   gdde   e       gg   l                   gsssnqflsnttrntvgrp
                                                             a   c vikm nqkqppen
                                                                    hhl epema  g
                                                                      h         

       490       500       510 
....:....|....:....|....:....|.
                               
lid-----------------------l----
tfrlstleqiwllvgvgvdgvvllgv-ysrk
rvnvafktlrcdatpmteadmridesyfed 
statpwwsclvkvslfllvawnvfsavrgh 
grpkm  lakta f a  g lit lf l   
fdli   i  l  a      ca     k   
   f   c                       
© 1998-2022Legal notice