Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlgpfkknaviglnlycggaglgagsgasaspsggrlltngkgtavesspprldggevgasttttaaaavglrggsggan
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ppdpvvpgvrgvarpapigaeardvtapprpfffapggrcsppaevadgaadalsspgyewdgyepelpgkrparlampp
                             mahpgrlprsyenreqavpylsykilqkednlsqf danrteasegteils
                               e af  misdescl mkrireq   r          gnlrt  spsl  
                                      gh    i d f h                             
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           .    
-------------------------d---medalyhyslmlatdylrhvavmtrltsclr--ra--tlrrvgd-gvqrny
lvregpdtssnargslpstpppape-edeeageefgqvhldiqrtikeqqqgpkdgkp-hsg--sqi-qkaafrsfeeev
tangsgswgifsnqprhtpl ahea sravs-ctg-s-se--he--pva---q-----q-ppktleap-e--- e slrh
v asa av                q lmt--t---r-t--pv--av---t kmgaavspv  vvps- a- tm d kq l
                           a tt  aren rr psp  eac  acapega s    hl   q    a a   
                             s    a e p   p   a     a   a  e         a          
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   .            
erafqtmlstLdits-dtarrifssvveevfsdGv-NWGRivtlfsFggili-------rhsvsltmevl-driaewiae
rtdmegftrqahskpveedikavnr-mtkl-r--it------aiia--afvcemekkllverkpinqdthveplshsmtd
 ktysdlsgk sl-nlgc-yqs-eqe-nhemeq -i    va-f-- a-ama   eqrkkqladkesssciae-tsf--t
 ae rqrfec kaq- --p--r --  --- -  gf      v-vv   ---    ee q  rrrrekps -- ---lc-
    ke   a    l vq pg- it  a m d             e   v l          gn    mi rs  le  h
    d               e  ap                                      l                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .       .                
ylvnskreWirqngGW-------------------------------------tgfvel-ygnnsayegrrnlltae---
vimknlad-lqkqk--viahskyqesqrisiflsmqdeieteeiikdifkqgedtviprrfkvemnwpsmvrvslf-wei
f-dehidp -me--                                gvwissk-clldf whfddlpmdikgqfslnfsw
- ------  --                                        snq hkn ttrsa-eg---dterst nv
  nrk hn   d                                         mp chh  sqqtva-qvt-rpvki   
      ga                                             ca      npkqs-spsmpkm  d   
                                                             el pp  ngd i   c   
                                                                     f          

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------------l
fslrktswnihqpgddevreealstggldlifmpglgfdqqgnrlgrgkgyydtylkrcfqhqkrrpytialafkeqic-
l fpw                                                                          f
   lt                                                                          d
   k                                                                           y
                                                                               c
                                                                                
                                                                                

       490       500       510
....:....|....:....|....:....|
                              
avgagvgg----gllyl-k-----------
l------avvll-----vrvpfwlallkvf
-tvvted-mridevalsr-           
sgpmlladlitqasyfeil           
islsagfvccg  wq gd            
 ka       e  a  ah            
                              
                              
© 1998-2021Legal notice