Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-02      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-03      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-02      PRLDGGEVGAS------AAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-03      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      ----------MAHPGR--RGYDNREIVMKYIHYKLSQRGYEW----DAGN
A0A7N4P3X2_BCL2L1-      ----------MPEPAFLPRISEESCQADPRLREQLSQKGYNWSQFEDENR
A0A7N4P3X2_BCL2L1-      ------------------MSHSNRELVVDFLSYKLSQKGYNWSQFEDENR
A0A7N4P573_BCL2A1-      -------------------------MADCEFHYVHMLAQDYLKHVQQMPR
A0A7N4PRP1_MCL1-01      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-02      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-03      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4P573_BCL2A1-      -----------------------MAAAAALSGFKRNLRAEMKQRLRALS-
A0A7N4P7T7_BCL2L10      -----------------------METEDALREETRRLVSDYLEHC---CR
A0A7N4P573_BCL2A1-      -------------------------MADCEFHYVHMLAQDYLKHVQQMPR
A0A7N4P573_BCL2A1-      -------------------------MADCEFHYVHMLAQDYLKHVQQMPR
                                                                          

A0A7N4PQN7_BCL2-01      LRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAARNSP
A0A7N4P3X2_BCL2L1-      TEASEGTEIPSTVNGSPSW--------------HPADSRAVSGATGHSSS
A0A7N4P3X2_BCL2L1-      TEASEGTEIPSTVNGSPSW--------------HPADSRAVSGATGHSSS
A0A7N4P573_BCL2A1-      --------------------------------------------LGSCLH
A0A7N4PRP1_MCL1-01      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-02      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-03      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4P573_BCL2A1-      --------------------------------------------AEERLR
A0A7N4P7T7_BCL2L10      --------------------------------------------AEGCQE
A0A7N4P573_BCL2A1-      --------------------------------------------LGSCLH
A0A7N4P573_BCL2A1-      --------------------------------------------LGSCLH
                                                                          

A0A7N4PQN7_BCL2-01      LPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDFSRRYRRDFDEMSGQ
A0A7N4P3X2_BCL2L1-      LDAHETIPVAAVKQ-------------ALREAGDEFELRYRRAFSDLTSQ
A0A7N4P3X2_BCL2L1-      LDAHETIPVAAVKQ-------------ALREAGDEFELRYRRAFSDLTSQ
A0A7N4P573_BCL2A1-      ----------------------RTSQILQKVAF-SVQEEVEKDMETFLST
A0A7N4PRP1_MCL1-01      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4PRP1_MCL1-02      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4PRP1_MCL1-03      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4P573_BCL2A1-      ----------------------QSRLLTEKVIAHSKYQESQRISIFLSMQ
A0A7N4P7T7_BCL2L10      ----------------------RAPSTPAAATMRAVAQELRRTYRDFFEC
A0A7N4P573_BCL2A1-      ----------------------RTSQILQKVAF-SVQEEVEKDMETFLST
A0A7N4P573_BCL2A1-      ----------------------RTSQILQKVAF-SVQEEVEKDMETFLST
                                                                      :   

A0A7N4PQN7_BCL2-01      LHLTPVTARGRF-ATVVEELFRDGV-NWGRIVAFFEFGGVMC---VESVN
A0A7N4P3X2_BCL2L1-      LHITPGTAYQSF-EQVVNELFRDGV-NWGRIVAFFSFGGALC---VESVD
A0A7N4P3X2_BCL2L1-      LHITPGTAYQSF-EQVVNELFRDGV-NWGRIVAFFSFGGALC---VESVD
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
A0A7N4PRP1_MCL1-01      LDIKNEEDIKAV-SRVVTHVFSDGVTNWGRIVTLISFGAFVA---KHLKS
A0A7N4PRP1_MCL1-02      LDIKNEEDIKAV-SRVVTHVFSDGVTNWGRIVTLISFGAFVA---KHLKS
A0A7N4PRP1_MCL1-03      LDIKNEEDIKAV-SRVVTHVFSDGVTNWGRIVTLISFGAFVA---KHLKS
A0A7N4P573_BCL2A1-      DEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMVRLFSAEEI---FSLPK
A0A7N4P7T7_BCL2L10      AKSQLLDQPPERVIPEVAEMMDQGGFNWGRVAVLVVFAGAMLEMEEQEKQ
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
                                            :     * . :  .  *..           

A0A7N4PQN7_BCL2-01      REMSPLVD---SIAL-----------WMTEYLNRHLHNWIQDNGGWD---
A0A7N4P3X2_BCL2L1-      KEMEVLVA---RITS-----------WMATYLDEHLDPWIQENGGWD---
A0A7N4P3X2_BCL2L1-      KEMEVLVA---RITS-----------WMATYLDEHLDPWIQENGGWD---
A0A7N4P573_BCL2A1-      HRAPLTMDTHEEISH-----------FIAEFIMNNIAEWIRQNGGWVIAH
A0A7N4PRP1_MCL1-01      INQESCID---PLAE-----------SITDVLVKSKRDWLMKQKGWEMPL
A0A7N4PRP1_MCL1-02      INQESCID---PLAE-----------SITDVLVKSKRDWLMKQKGWE-GF
A0A7N4PRP1_MCL1-03      INQESCID---PLAE-----------SITDVLVKSKRDWLMKQKGWE-GF
A0A7N4P573_BCL2A1-      TSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGRGKGY----
A0A7N4P7T7_BCL2L10      QRGRLRSEMSRRLAE-----------ELCHYLVEKKGAWLRENGGW----
A0A7N4P573_BCL2A1-      HRAPLTMDTHEEISH-----------FIAEFIMNNIAEWIRQNGGWG---
A0A7N4P573_BCL2A1-      HRAPLTMDTHEEISH-----------FIAEFIMNNIAEWIRQNGGW----
                                    :              :          .:    *:    

A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      SKYQESQRISIFLSMQDEIETEEIIKDIFKQGKTCFIPRYKFNSNYMDMV
A0A7N4PRP1_MCL1-01      CDLR----------------------------------------------
A0A7N4PRP1_MCL1-02      VEF-----------------------------------------------
A0A7N4PRP1_MCL1-03      VEF-----------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      RLFSAEEIFSLPKTSWNIHQPGDDEVREEALS----TGGLDLIFMPGLGF
A0A7N4PRP1_MCL1-01      ---------------WSL-QPSPSPVMNLLVSEYSKGSGLGVLCEQGW--
A0A7N4PRP1_MCL1-02      ---------------FHV-EDLEGGIRNVLLA-FAGVAGVGA----GL--
A0A7N4PRP1_MCL1-03      ---------------FHV-EDLEGGIRNVLLA-FAGVAGVGA----GL--
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      -----------AFVELYGNSM-------RPLFDFSWLSLKTLLSLALVGA
A0A7N4P3X2_BCL2L1-      -----------TFVELYGNDAAAESRKGQERFN------RWLLTGMTVAG
A0A7N4P3X2_BCL2L1-      -----------TFVELYGNDAAAESRKGQERFN------RWLLTGMTVAG
A0A7N4P573_BCL2A1-      DQQGNRLGRGKGYYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDD
A0A7N4PRP1_MCL1-01      ----------------------------QYLVLVPFWLALLKVF------
A0A7N4PRP1_MCL1-02      ----------------------------AYLIR-----------------
A0A7N4PRP1_MCL1-03      ----------------------------AYLIR-----------------
A0A7N4P573_BCL2A1-      -------------YDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDD
A0A7N4P7T7_BCL2L10      ---------------TGFHHHFTQKQPPPQSDPKSTLCCIVAAAGFGLVG
A0A7N4P573_BCL2A1-      ---------VWISSSCQVLDLTNRETAWEGGRDTMTLT------------
A0A7N4P573_BCL2A1-      --------------ENGFIKNFEPNMVWPNFTDISTKI------------
                                                                          

A0A7N4PQN7_BCL2-01      CITLGAYLGHK
A0A7N4P3X2_BCL2L1-      VVLLGSLFSRK
A0A7N4P3X2_BCL2L1-      VVLLGSLFSRK
A0A7N4P573_BCL2A1-      MRIDEVLYEDK
A0A7N4PRP1_MCL1-01      -----------
A0A7N4PRP1_MCL1-02      -----------
A0A7N4PRP1_MCL1-03      -----------
A0A7N4P573_BCL2A1-      MRIDEVLYEDK
A0A7N4P7T7_BCL2L10      LALLLAVR---
A0A7N4P573_BCL2A1-      -----------
A0A7N4P573_BCL2A1-      WNVFSFLK---
                                   

© 1998-2022Legal notice