Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3WBC5_MCL1-01        DVTAPPRPFFFAPGGRCSPPAEVADGAADAI---LSPEDELDGYEPELPG
G3WPT1_BCL2L2-01      HSSSPIFFSLPFIASQMATPA-SAPDTRALVADFVGYKLRQKGYA-----
G3WPT1_BCL2L2-02      ----------------MATPA-SAPDTRALVADFVGYKLRQKGYA-----
G3WSP8_BCL2A1-01      ------------------MADCEFHYVHMLAQDYLKH-------------
G3WKX6_BCL2L1-01      ----------------------MSHSNRELVVDFLSYKLSQKGYNWS---
G3WZW9_BCL2-01        ----------------MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGN
G3WZW9_BCL2-02        PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD-----
                                                        :               

G3WBC5_MCL1-01        KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
G3WPT1_BCL2L2-01      --------------------------------------------------
G3WPT1_BCL2L2-02      --------------------------------------------------
G3WSP8_BCL2A1-01      --------------------------------------------------
G3WKX6_BCL2L1-01      ----------------------QFEDENRTEASEGTEIPSTVNGSPSWHP
G3WZW9_BCL2-01        LRTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAARNSP
G3WZW9_BCL2-02        --------------------------------------------------
                                                                        

G3WBC5_MCL1-01        LITRYLRE---QAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGML
G3WPT1_BCL2L2-01      -----------CGTGPGEGPTNEP--LHRAMRAAGDEFESRFRRTFSDLA
G3WPT1_BCL2L2-02      -----------CGTGPGEGPTNEP--LHRAMRAAGDEFESRFRRTFSDLA
G3WSP8_BCL2A1-01      -----------VQQMPRLGSCLHR--TSQILQKVAFSVQEEVEKDMETFL
G3WKX6_BCL2L1-01      ADSRAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLT
G3WZW9_BCL2-01        LPPPPAVAAATVAAGPAVSPVPPV--VHLTLRQAGDDFSRRYRRDFDEMS
G3WZW9_BCL2-02        -----------VAAGPAVSPVPPV--VHLTLRQAGDDFSRRYRRDFDEMS
                                                    :. ..  ..      :. : 

G3WBC5_MCL1-01        RKLDIKNE-EDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSI
G3WPT1_BCL2L2-01      AQLHVTPG-SAQQRFTQVSDELFQGG-ANWGRLVAFFVFGAALCAESVNK
G3WPT1_BCL2L2-02      AQLHVTPG-SAQQRFTQVSDELFQGG-ANWGRLVAFFVFGAALCAESVNK
G3WSP8_BCL2A1-01      STLDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGIL-IKKLLR
G3WKX6_BCL2L1-01      SQLHITPG-TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDK
G3WZW9_BCL2-01        GQLHLTPV-TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNR
G3WZW9_BCL2-02        GQLHLTPV-TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNR
                        * :.        .  *    * .*  ****:*::: **. :       

G3WBC5_MCL1-01        NQESCI----DPLAESITDVLVKSKRDWLMKQKGWEGFVEFFHVEDLEGG
G3WPT1_BCL2L2-01      EMEPLV----GQEKRYGVHLKQGILARYLPSKAGAAEFTALYGDGALEEA
G3WPT1_BCL2L2-02      EMEPLV----GQVQDWMVTYLETQLADWIHSSGGWAEFTALYGDGALEEA
G3WSP8_BCL2A1-01      HRAPLTMDTHEEISHFIAEFIMNNIAEWIRQNGGWE-----NGFIKNFEP
G3WKX6_BCL2L1-01      EMEVLV----ARITSWMATYLDEHLDPWIQENGGWDTFVELYGNDAAAES
G3WZW9_BCL2-01        EMSPLV----DSIALWMTEYLNRHLHNWIQDNGGWGTKAICMGTSGPFQV
G3WZW9_BCL2-02        EMSPLV----DSIALWMTEYLNRHLHNWIQDNGGW------VGVSA----
                                       .         :: .. *                

G3WBC5_MCL1-01        IRNVLLAFAGVAGVGAGLAYLIR-----------
G3WPT1_BCL2L2-01      RRLREGNWASVRTVLTGAVALGALVTVGAFFASK
G3WPT1_BCL2L2-02      RRLREGNWASVRTVLTGAVALGALVTVGAFFASK
G3WSP8_BCL2A1-01      NM----VWPNFTDISTKIWNVFSFLK--------
G3WKX6_BCL2L1-01      RK----GQERFNRWLLTGMTVAGVVLLGSLFSRK
G3WZW9_BCL2-01        S---------------------------------
G3WZW9_BCL2-02        ----------------------------------
                                                        

© 1998-2020Legal notice