Dataset for protein BCL-2-like of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-02      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-03      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P3X2_BCL2L1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-02      PRLDGGEVGAS------AAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-03      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      ---------MAHPGR--RGYDNREIVMKYIHYKLSQRGYEW----DAGNL
A0A7N4P3X2_BCL2L1-      ---------MPEPAFLPRISEESCQADPRLREQLSQKGYNWSQFEDENRT
A0A7N4P3X2_BCL2L1-      -----------------MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRT
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-02      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-03      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      RTPASPSLPPVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAARNSPL
A0A7N4P3X2_BCL2L1-      EASEGTEIPSTVNGSPSW--------------HPADSRAVSGATGHSSSL
A0A7N4P3X2_BCL2L1-      EASEGTEIPSTVNGSPSW--------------HPADSRAVSGATGHSSSL
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4PRP1_MCL1-01      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-02      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-03      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4P7T7_BCL2L10      -------------------------------------METEDALREETRR
A0A7N4P573_BCL2A1-      ---------------------------------------MADCEFHYVHM
A0A7N4P573_BCL2A1-      ---------------------------------------MADCEFHYVHM
A0A7N4P573_BCL2A1-      ---------------------------------------MADCEFHYVHM
                                                                          

A0A7N4PQN7_BCL2-01      PPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGD-DFSRRYRRDFDEMSGQ
A0A7N4P3X2_BCL2L1-      DAHETIPVAAVKQ-------------ALREAGD-EFELRYRRAFSDLTSQ
A0A7N4P3X2_BCL2L1-      DAHETIPVAAVKQ-------------ALREAGD-EFELRYRRAFSDLTSQ
A0A7N4P573_BCL2A1-      ------------MAAAAALS--------------GFKRNLRAEMKQRLRA
A0A7N4PRP1_MCL1-01      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4PRP1_MCL1-02      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4PRP1_MCL1-03      LITRYLREQAVGTKDTKPLRSGKALETLRRVGD-GVQRNHETAFQGMLRK
A0A7N4P7T7_BCL2L10      LVSDYLEHC---CRAEGCQE--RAPSTPAAATMRAVAQELRRTYRDFFEC
A0A7N4P573_BCL2A1-      LAQDYLKHVQQMPRLGSCLH--RTSQILQKVAF-SVQEEVEKDMETFLST
A0A7N4P573_BCL2A1-      LAQDYLKHVQQMPRLGSCLH--RTSQILQKVAF-SVQEEVEKDMETFLST
A0A7N4P573_BCL2A1-      LAQDYLKHVQQMPRLGSCLH--RTSQILQKVAF-SVQEEVEKDMETFLST
                                                           .              

A0A7N4PQN7_BCL2-01      LHLTP-VTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVMC-------V
A0A7N4P3X2_BCL2L1-      LHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGALC-------V
A0A7N4P3X2_BCL2L1-      LHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGALC-------V
A0A7N4P573_BCL2A1-      LSA------------------------------------------EERLR
A0A7N4PRP1_MCL1-01      LDIKN-EEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVA-------K
A0A7N4PRP1_MCL1-02      LDIKN-EEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVA-------K
A0A7N4PRP1_MCL1-03      LDIKN-EEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVA-------K
A0A7N4P7T7_BCL2L10      AKSQLLDQPPERVIPEVAEMMDQGGFNWGRVAVLVVFAGAMLEMEEQEKQ
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
A0A7N4P573_BCL2A1-      LDITSVDCARRIFNSVMEKEFEDGIINWGRIVTIFAFGGILI---KKLLR
                                                                          

A0A7N4PQN7_BCL2-01      ESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGW--------------
A0A7N4P3X2_BCL2L1-      ESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGW--------------
A0A7N4P3X2_BCL2L1-      ESVDKEMEVLVARITSWMATYLDEHLDPWIQENGGW--------------
A0A7N4P573_BCL2A1-      QSRLLTEKVI----------------------------AHSKYQESQRIS
A0A7N4PRP1_MCL1-01      HLKSINQESCIDPLAESITDVLVKSKRDWLMKQKGW--------------
A0A7N4PRP1_MCL1-02      HLKSINQESCIDPLAESITDVLVKSKRDWLMKQKGW--------------
A0A7N4PRP1_MCL1-03      HLKSINQESCIDPLAESITDVLVKSKRDWLMKQKGW--------------
A0A7N4P7T7_BCL2L10      QRGRLRSEMS-RRLAEELCHYLVEKKGAWLRENGGW--------------
A0A7N4P573_BCL2A1-      HRAPLTMDTH-EEISHFIAEFIMNNIAEWIRQNGGWVIAHSKYQESQRIS
A0A7N4P573_BCL2A1-      HRAPLTMDTH-EEISHFIAEFIMNNIAEWIRQNGGW--------------
A0A7N4P573_BCL2A1-      HRAPLTMDTH-EEISHFIAEFIMNNIAEWIRQNGGW--------------
                               .                                          

A0A7N4PQN7_BCL2-01      -----------------------DAFVEL-YGNSM-------RPLFDFSW
A0A7N4P3X2_BCL2L1-      -----------------------DTFVEL-YGNDAAAESRKGQERFN---
A0A7N4P3X2_BCL2L1-      -----------------------DTFVEL-YGNDAAAESRKGQERFN---
A0A7N4P573_BCL2A1-      IFLSMQDEIETEEIIKDIFKQGKTCFIPR-YKFNSNYMDMVRLFSAE-EI
A0A7N4PRP1_MCL1-01      ----------------------EMPLCDLRWSLQPSPSPVMNLLVSE---
A0A7N4PRP1_MCL1-02      ----------------------E-GFVEF-FHVEDLEGGIRNVLLA----
A0A7N4PRP1_MCL1-03      ----------------------E-GFVEF-FHVEDLEGGIRNVLLA----
A0A7N4P7T7_BCL2L10      -----------------------TGFHHH-FTQKQPPPQSDPKSTLC---
A0A7N4P573_BCL2A1-      IFLSMQDEIETEEIIKDIFKQGKTCFIPR-YKFNSNYMDMVRLFSAE-EI
A0A7N4P573_BCL2A1-      ----------------GVWISSSCQVLDL-TNRETAWEGGRDTMTLT---
A0A7N4P573_BCL2A1-      ----------------------ENGFIKN-FEPNMVWPNFTDISTKIWNV
                                                 .       .                

A0A7N4PQN7_BCL2-01      LSLKT---------------------------------------------
A0A7N4P3X2_BCL2L1-      ---RW---------------------------------------------
A0A7N4P3X2_BCL2L1-      ---RW---------------------------------------------
A0A7N4P573_BCL2A1-      FSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGRGKG
A0A7N4PRP1_MCL1-01      --------------------------------------------------
A0A7N4PRP1_MCL1-02      --------------------------------------------------
A0A7N4PRP1_MCL1-03      --------------------------------------------------
A0A7N4P7T7_BCL2L10      --------------------------------------------------
A0A7N4P573_BCL2A1-      FSLPKTSWNIHQPGDDEVREEALSTGGLDLIFMPGLGFDQQGNRLGRGKG
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      FSFLK---------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      -----------------------------LLSLALVGACITLGAYLGHK-
A0A7N4P3X2_BCL2L1-      -----------------------------LLTGMTVAGVVLLGSLFSRK-
A0A7N4P3X2_BCL2L1-      -----------------------------LLTGMTVAGVVLLGSLFSRK-
A0A7N4P573_BCL2A1-      YYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYEDK-
A0A7N4PRP1_MCL1-01      -----------------------------YSKGSGLGVLCEQGWQYLVLV
A0A7N4PRP1_MCL1-02      -----------------------------FAGVAGVGA----GLAYLIR-
A0A7N4PRP1_MCL1-03      -----------------------------FAGVAGVGA----GLAYLIR-
A0A7N4P7T7_BCL2L10      -----------------------------CIVAAAGFGLVGLALLLAVR-
A0A7N4P573_BCL2A1-      YYDTYLKRCFQHQKRRPYTIALAFKEQICDAVPVGEDDMRIDEVLYEDK-
A0A7N4P573_BCL2A1-      --------------------------------------------------
A0A7N4P573_BCL2A1-      --------------------------------------------------
                                                                          

A0A7N4PQN7_BCL2-01      ----------
A0A7N4P3X2_BCL2L1-      ----------
A0A7N4P3X2_BCL2L1-      ----------
A0A7N4P573_BCL2A1-      ----------
A0A7N4PRP1_MCL1-01      PFWLALLKVF
A0A7N4PRP1_MCL1-02      ----------
A0A7N4PRP1_MCL1-03      ----------
A0A7N4P7T7_BCL2L10      ----------
A0A7N4P573_BCL2A1-      ----------
A0A7N4P573_BCL2A1-      ----------
A0A7N4P573_BCL2A1-      ----------
                                  

© 1998-2021Legal notice