Dataset for protein BCL-2-like of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

14 sequence(s)

>gnl|bcl2dbpro|A0A673VWA7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=285 residues).
MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFHGAGAICAGASPKSKVDMGNGTGDTPPRPTTLGVNVVKSNGLDNH
LSDRSNNDDSLPCTPQMASECGPELSNCPSGDEVLEDDTRQLIENFLGDYTGLSHPRWKQSKPLTTMKRVVEDVIAKHRY
AYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
LIKNNAWNGFVEFFHVQDPESSVRNTLLAIAGVAGIGATLAMFIR
>gnl|bcl2dbpro|A0A673Z0A3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=230 residues).
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNSPEVFARRSQPSAEGVDTESQLPNRIPQPDR
HARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTTQ
VDNIAHWMTEYLNGPLQNWIQENGDWDAFVEIYGQQRISVFHSWPYLKTVFGLAALGAAGVTIGALFIQK
>gnl|bcl2dbpro|A0A673Z4J6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=216 residues).
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDEAIANGSVGNSRSNLAKPSSPQGGMEPVKAALRDSVDEFEL
RYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQ
PWIQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLAGVILLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A674B0E5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=226 residues).
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRLGLARRCHGANNAGPGSVPSLSKWLSQPDPHAAI
HRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREVIDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHI
AVWMTEYLNGPLLSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A674B8T7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salmo trutta GN=BCL-2 (length=228 residues).
MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTDPPYQNRSPQPDP
HARLHRVLREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQ
VDNIARWMMEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|A0A674C337_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=228 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEGGQVEGGAAVITYVNGTSPGTPPPRQSPPSSPRRTAGLDAVK
EALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRIT
DWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSIFAQKRL
>gnl|bcl2dbpro|A0A674C4N2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGKPSSPQGGIEAVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSHLVMRIADWMATYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
>gnl|bcl2dbpro|A0A674C578_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=231 residues).
IMTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSPGTPPRQSPPSSPQRTMGLD
AVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVG
RIADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A674C578_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salmo trutta GN=BCL2L1 (length=230 residues).
MCINLSELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSPGTPPRQSPPSSPQRTMGLDA
VKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGR
IADWMTVYLDNHIQPWIQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTLVTGVIVGSLIAQKRL
>gnl|bcl2dbpro|A0A674D165_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=306 residues).
MLRFQSGLLAFPEFKLYSNVGYVTIAGTKHCIICASPPGQDHYIACPEIGNLLKTKLKHLKLSGSIDSTPLFTRRGPGHE
YSWGGLEPDSALAYDTTNFGVLLPHTVDTHKCFMCNLEINNFISHQETYHHQTGALDTDTRQLIKCVLGQCTGLLKPRWN
ESKALSTMSRVVGQLLEKHRYTYNGMINTLYVDDRGDDVKFLSAVAHIIFQDGTVNWGRVASLTSFGAAVCQYLKDKGRD
NCVEVAGEEISAYLVTHHKDWLVKHNSWNGFVEFFPVAEPESRSRNIIMTPVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A674D1T7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=185 residues).
SPNRLTAPSPSREGTYPPRDITRNSLNGQCTGLLKPRWNESKALSTMSRVVGQLLEKHRYTSNGMINTLYVDDRGDDVKF
LSAVTHIIFQDGTVNWGRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDWLVKHNSWNGFVEFYPVAEPE
SRSRNIIITLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A674ELG3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=300 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRQFPAQPQGCVVCL
>gnl|bcl2dbpro|A0A674ELG3_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=291 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRNSAD
>gnl|bcl2dbpro|A0A674ELG3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salmo trutta GN=MCL-1 (length=288 residues).
MSLSFTRATTTILNFQNGVVGGSSYPAGTPLCYFGETVCAGASPKSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHI
SDRSNDDDSDGSLPCTPQMASECGPELSNCPSGDEVLEHDTRQLIENLLGDYTGLSPPRWKQSKALTTMTRVVKDIIAKH
QYAYNGMIAKLELDDRSDDMSFINSVAKTLFSDGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQR
DWLVKNNAWNGFVEFFHVQDPESSVRNALIAFAGFAGLGATLAMLIRN
© 1998-2020Legal notice