Dataset for protein BCL-2-like of organism Salmo trutta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----m-ynnrelvvyfinyklsqrsypa----------------------------------------tklglnvapsn
mslndsftratttilnyqtgvvggsgfvwysgtplcyfhggetvcagaspkskvdtdlgngtgdtpprpnh--vtevknr
 masnnt----fimek--sh--lk-d--fddnvgyytia tkhiiic   pgqd   m           -fiv-egssg-
 andm-sisss----f  h-r --pn sc  ar  v    agac                         c-qpe-d---p
    i p  l     -  - l anm- l-                                        kqneah-iqca
    e i        r  c    fke kl                                        etmd  yee  
      c        h           a                                         d ea    a  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tegnhasdrs------nngdsngslpctpqmqse----------------------------------------------
vq-gqiegnapavttrrsdaadatvdssspranrgpgheyswgglepdsalaydttnfgvllphtvdthkcfmcgpelsn
gfndps--g-lelfahpdqp-a-gsgt-rsl--p                                        nl in 
--d-elip-r srlry-h-tt-l p-gvdlytr-                                              
en e--ttpl n innv-psrse y -r itskw                                              
al  svpskg g g ak lrnp  k pe  nras                                              
 i  lmka     a  c  kle  i nd  gp k                                              
                   i    e     fl                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              :     :.   :      :   * .        .
------------------------------tglpqprwglskvlttlrrvvdeielkyqrafngmssqLhltprtadmsF
cpsgdetyhhqtgvlehdtrqlienllgdypsssprtakqhaak-amtdsgndfiarhrydysdliak yiddssdyrrv
fi hq        a dt      kcvn qc-pqld-h-ridrp-e- seaakqllrm aptsae vnt ev sag qqk 
                d        f    s---kg-mneep  s  k   g v el t       g  df   c evg 
                              l   -   am    a      e   i          h          h  
                              i   r                                             
                                  h                                             
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *   :* ** .****: .:  **..:.    :      :      :  **      *: .:. *: *.*::      
-esVmdelFrDG-vNWGRvvslfaFGgavcvelvekgmshcveriadwmttYLdnhiqdWiqknggWdgFvEifgvdape
ina aktv s  tt    iagfvs  avlsqrcknrergpliglvgqniav  lsdqrp lvsqna nr a fyh-qdaa
ltn ihii q  i      ia te   tm  ys dmd tsq dvatee se  ngplkn  ieh s ea   pr----
 se te m                    i  h      dn  mn  v  ma  vt hss      d        ekae  
 r                                    nt  ah  r   k      l                dm    
                                              h                                 
                                                                                
                                                                                

       330       340       350       360         
....:....|....:....|....:....|....:....|....:....
   .              :        .  :   .              
ssrrn------w----tll--ag-agtGvtvgmlirqk-----------
--vqsqesfkk-llagmvial--l-vlsallasyfm--rlqpqgcvvcl
evskrisvlhs pylkatfgfvafgai liitaivanspq         
drq  d  ir   sv vimtp  v la  am tfltkfcd         
         i    i im  i     s  v  l  i  aa         
         c                                       
                                                 
                                                 
© 1998-2020Legal notice