Dataset for protein BCL-2-like of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674D1T7_MCL1-01      --------------------------------------------------
A0A673Z0A3_BCL2-01      MMANDNPYNSRFIVEKYIHHKLLKKGFVW---------------------
A0A674B8T7_BCL2-01      MMANENPYNSRFIVEKYIHHKLLNMGFVW---------------------
A0A674B0E5_BCL2-01      MANDDN----RFIVEKYICHKLLKRGYAW---------------------
A0A673Z4J6_BCL2L1-      -----MSYSNRELVVFFISYRLSQRNYSC---------------------
A0A674C337_BCL2L1-      ----MMTYNNRELVVYYITYKLSQRDYPF---------------------
A0A674C578_BCL2L1-      -----MCINLSELVVYYITYKLSQRDYPF---------------------
A0A674C4N2_BCL2L1-      -----MSYSNRELVVFFISYKLSQRNYPC---------------------
A0A674C578_BCL2L1-      ----IMTYNNRELVVYYITYKLSQRDYPF---------------------
A0A674D165_MCL1-01      -------------MLRFQSGLLAFPEFKLYSNVGYVTIAGTKHCIICASP
A0A673VWA7_MCL1-01      MSLSNSITRATTTMLHFQN---GGSSYLADDARPLYYFHGAGAICAGASP
A0A674ELG3_MCL1-01      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A674ELG3_MCL1-03      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
A0A674ELG3_MCL1-02      MSL--SFTRATTTILNFQNGVVGGSSYPA--GTPLCYF--GETVCAGASP
                                                                          

A0A674D1T7_MCL1-01      ---------------------------------------SPNRLTAPSPS
A0A673Z0A3_BCL2-01      -------------------EFNPENDSPNNGFGEPSPPNSPEVFARRSQP
A0A674B8T7_BCL2-01      -------------------KFQAENDSPNNGFGDPSTPNSPEVFARRSQP
A0A674B0E5_BCL2-01      -------------------DFEDAEEEEGAANNGSMISPRLGLARRCHGA
A0A673Z4J6_BCL2L1-      -------------------CQLGLEGASGRTEGDEA-------------I
A0A674C337_BCL2L1-      -------------------NHMELTEAQNRTEGGQVEGGA-AVITYVNGT
A0A674C578_BCL2L1-      -------------------NHIGLTEAPSRTEGGQAEGGA-AVTTHPNGA
A0A674C4N2_BCL2L1-      -------------------CQLVLEGASGRTEGDEAIANG-SLGNNRNGR
A0A674C578_BCL2L1-      -------------------NHIGLTEAPSRTEGGQAEGGA-AVTTHPNGA
A0A674D165_MCL1-01      PGQD--------------------HYIACPEIGNLLKTKL------KHLK
A0A673VWA7_MCL1-01      KSKV--DMGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRS------NNDD
A0A674ELG3_MCL1-01      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRS------NDDD
A0A674ELG3_MCL1-03      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRS------NDDD
A0A674ELG3_MCL1-02      KSKVDTDLGNGTGDTPPRPTKLGVNVVKSNVQGNHISDRS------NDDD
                                                                          

A0A674D1T7_MCL1-01      REGTYPPRDITRNS------------------------------------
A0A673Z0A3_BCL2-01      SAEGVDTESQLPNR------------------------------------
A0A674B8T7_BCL2-01      TAAGEDTDPPYQNR------------------------------------
A0A674B0E5_BCL2-01      NNAGPGSVPSLSKW------------------------------------
A0A673Z4J6_BCL2L1-      ANGSVGNSRSNLAK------------------------------------
A0A674C337_BCL2L1-      SPGTP---PPRQSP------------------------------------
A0A674C578_BCL2L1-      ANGTSPGTPPRQSP------------------------------------
A0A674C4N2_BCL2L1-      SNLGKPSSPQG---------------------------------------
A0A674C578_BCL2L1-      ANGTSPGTPPRQSP------------------------------------
A0A674D165_MCL1-01      LSGSIDSTPLFTRRGPGHEYSWGGLEPDSALAYDTTNFGVLLPHTVDTHK
A0A673VWA7_MCL1-01      ---SLPCTPQMASE------------------------------------
A0A674ELG3_MCL1-01      SDGSLPCTPQMASE------------------------------------
A0A674ELG3_MCL1-03      SDGSLPCTPQMASE------------------------------------
A0A674ELG3_MCL1-02      SDGSLPCTPQMASE------------------------------------
                                                                          

A0A674D1T7_MCL1-01      -----------------------------------LNGQCTGLLKPRWNE
A0A673Z0A3_BCL2-01      ----------------------------------------IPQPDRHARL
A0A674B8T7_BCL2-01      ----------------------------------------SPQPDPHARL
A0A674B0E5_BCL2-01      ----------------------------------------LSQPDPHAAI
A0A673Z4J6_BCL2L1-      ----------------------------------------PSSPQG--GM
A0A674C337_BCL2L1-      ----------------------------------------PSSPRRTAGL
A0A674C578_BCL2L1-      ----------------------------------------PSSPQRTMGL
A0A674C4N2_BCL2L1-      ------------------------------------------------GI
A0A674C578_BCL2L1-      ----------------------------------------PSSPQRTMGL
A0A674D165_MCL1-01      CFMCNLEINNFISHQETYHHQTGALDTDTRQLIKCVLGQCTGLLKPRWNE
A0A673VWA7_MCL1-01      ---CGPELSNCPSGDE-------VLEDDTRQLIENFLGDYTGLSHPRWKQ
A0A674ELG3_MCL1-01      ---CGPELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQ
A0A674ELG3_MCL1-03      ---CGPELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQ
A0A674ELG3_MCL1-02      ---CGPELSNCPSGDE-------VLEHDTRQLIENLLGDYTGLSPPRWKQ
                                                                          

A0A674D1T7_MCL1-01      SKALSTMSRVVGQLLEKHRYTSNGMINTLYVDDRGDDVKFLSAVTHIIFQ
A0A673Z0A3_BCL2-01      HRV---LREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRRF-TAVIEELFR
A0A674B8T7_BCL2-01      HRV---LREAGGEIERMYQRDFAEMSGQLHFTPSTAQRRF-TAVIDELFS
A0A674B0E5_BCL2-01      HRV---LREAGDELERLYQPDFAEMSHQLYLTSSTAERRF-REVIDELFR
A0A673Z4J6_BCL2L1-      EPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSF-ESVMDEVFR
A0A674C337_BCL2L1-      DAVKEALRDSANEFELRYARAFSDLSSQLHITPSTAYQSF-ENVMDEVFR
A0A674C578_BCL2L1-      DAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSF-ENVMDEVFR
A0A674C4N2_BCL2L1-      EAVKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSF-ESVMDEVFR
A0A674C578_BCL2L1-      DAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSF-ENVMDEVFR
A0A674D165_MCL1-01      SKALSTMSRVVGQLLEKHRYTYNGMINTLYVDDRGDDVKFLSAVAHIIFQ
A0A673VWA7_MCL1-01      SKPLTTMKRVVEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFS
A0A674ELG3_MCL1-01      SKALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFS
A0A674ELG3_MCL1-03      SKALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFS
A0A674ELG3_MCL1-02      SKALTTMTRVVKDIIAKHQYAYNGMIAKLELDDRSDDMSFINSVAKTLFS
                              :     :.   :      :   * .        .   *   :* 

A0A674D1T7_MCL1-01      DGTVNWGRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDW
A0A673Z0A3_BCL2-01      DG-VNWGRIVAFFEFGGTMCVESVNREMTTQVDNIAHWMTEYLNGPLQNW
A0A674B8T7_BCL2-01      DG-VNWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMMEYLNGPLQNW
A0A674B0E5_BCL2-01      DG-VNWGRIIAFFEFGGTICVECVNKEMTSQVDHIAVWMTEYLNGPLLSW
A0A673Z4J6_BCL2L1-      DG-VNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPW
A0A674C337_BCL2L1-      DG-VNWGRVVGLFSFGGALCVECVDKEMNPLVGRITDWMTVYLDNHIQPW
A0A674C578_BCL2L1-      DG-VNWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPW
A0A674C4N2_BCL2L1-      DG-VNWGRVVGLFAFGGALCVECVEKDMSHLVMRIADWMATYLDNHIQPW
A0A674C578_BCL2L1-      DG-VNWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPW
A0A674D165_MCL1-01      DGTVNWGRVASLTSFGAAVCQYLKDKGRDNCVEVAGEEISAYLVTHHKDW
A0A673VWA7_MCL1-01      DGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDW
A0A674ELG3_MCL1-01      DGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDW
A0A674ELG3_MCL1-03      DGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDW
A0A674ELG3_MCL1-02      DGTTNWGRIASLVAFGAVVSQRLKEMGRGHCIELVGQNIATYLLSDQRDW
                        ** .****: .:  **..:.    :      :      :  **      *

A0A674D1T7_MCL1-01      LVKHNSWNGFVEFYPVAEPESRSRN-----------IIITLVGLAGIGAA
A0A673Z0A3_BCL2-01      IQENGDWDAFVEIYG-------QQRISVFHSWPYLKTVFGLAALGAAGVT
A0A674B8T7_BCL2-01      IQENGGWDAFVEIYE-------QQRIS--HSWPYLKTVFGLAALGAAGVT
A0A674B0E5_BCL2-01      IQENGGWEAFVELYD-------RQRDSVFCSWPSIKTVFGLAALGAASLT
A0A673Z4J6_BCL2L1-      IQSQGGWDRFAEIFGRDAAADVRRSQESIIKWLLAGVIL------LSGVL
A0A674C337_BCL2L1-      IQSQGGWDRFAEIFGMDAAAESRKSQESFKKWLLAGMTL------VTGVV
A0A674C578_BCL2L1-      IQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTL------VTGVI
A0A674C4N2_BCL2L1-      IQSQGGWDRFAEIFGRDAAADVRRSQESLRKWLLVGVML------LSGVL
A0A674C578_BCL2L1-      IQSQGGWDRFAEIFGKDAAAESRKSQESFKKWLLAGMTL------VTGVI
A0A674D165_MCL1-01      LVKHNSWNGFVEFFPVAEPESRSRN-----------IIMTPVGLAGIGAA
A0A673VWA7_MCL1-01      LIKNNAWNGFVEFFHVQDPESSVRN-----------TLLAIAGVAGIGAT
A0A674ELG3_MCL1-01      LVKNNAWNGFVEFFHVQDPESSVRN-----------ALIAFAGFAGLGAT
A0A674ELG3_MCL1-03      LVKNNAWNGFVEFFHVQDPESSVRN-----------ALIAFAGFAGLGAT
A0A674ELG3_MCL1-02      LVKNNAWNGFVEFFHVQDPESSVRN-----------ALIAFAGFAGLGAT
                        : .:. *: *.*::         .              :        .  

A0A674D1T7_MCL1-01      MTLLVM-------------
A0A673Z0A3_BCL2-01      IGALFIQK-----------
A0A674B8T7_BCL2-01      IGALFTQK-----------
A0A674B0E5_BCL2-01      IGAYLTQK-----------
A0A673Z4J6_BCL2L1-      VGTLIMKKRQ---------
A0A674C337_BCL2L1-      VGSIFAQKRL---------
A0A674C578_BCL2L1-      VGSLIAQKRL---------
A0A674C4N2_BCL2L1-      VGTLIMKKCQ---------
A0A674C578_BCL2L1-      VGSLIAQKRL---------
A0A674D165_MCL1-01      MTLLVM-------------
A0A673VWA7_MCL1-01      LAMFIR-------------
A0A674ELG3_MCL1-01      LAMLIRQFPAQPQGCVVCL
A0A674ELG3_MCL1-03      LAMLIRNSAD---------
A0A674ELG3_MCL1-02      LAMLIRN------------
                        :   .              

© 1998-2020Legal notice