Dataset for protein BCL-2-like of organism Salarias fasciatus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A672GRK8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Salarias fasciatus GN=MCL-1 (length=303 residues).
MNIMSTNTKRAGLFGCLIFPQNGVMHYGSEDPTHQLPMGAGVDTLHGHVETPKRPKNLDVAAVNGYASKNLREDSEDVDD
GSLPCTPELHSDSEADVSYSAAGSEVLESDTRQLLSRYFSEFTGLSKTQRGESKPLSTMKRVVEDILAKHRYAYNGMINR
LSMEERGGDLRFLQSVARTLFSDGSTNWGRIASLVAFGAVVCQHMREQGRPDCVELVGQEISTYLLSEQRDWLIKNNSWD
GFVEFFHVADPESTVRNTLMAVAGFAGIGATLALLISCSGKGLKTSPRPKREEQAALVPVVQP
>gnl|bcl2dbpro|A0A672HHE5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Salarias fasciatus GN=BCL-2 (length=230 residues).
MENERNRNIVVKYICHKLSKRGYAWSLDAARDEDADNNGSLVDPEPTLVRRCREAAGAGPDSEDDSPRLCRRPQQSDPHA
AIHRVLREAGDELERLYQPDFTEMSRQLYLTSSTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECVSKEDMTAQV
DNIADWMTEYLNGPLDSWIRDNGGWDAFVDLYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A672IDC1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=252 residues).
MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSGPDQRTETHANGTFTSRSSGSPPPSPLRQLGA
GGGGGAGGGGGAGGGGGAGLDAVKEALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGL
FAFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTG
FVVGSLFAQKRL
>gnl|bcl2dbpro|A0A672IDC1_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=227 residues).
MSENRELVVFYITYKLSQRNYPLNHIVLNEPPSRTDGGDGGDAGDAGSGPDQRTETHANGTFTSRSSGSPPPSPLRQLGE
ALRDTANEFELRYSMAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVE
WMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVTGFVVGSLFAQKRL
>gnl|bcl2dbpro|A0A672JL90_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L1 (length=216 residues).
MSSSNRELVEFFLSHRLSQRNHPSSLLRPQDARQRTEEDQASSSASNGSVFSGSAGRSQSPRAETDPVKSALLDSADEFE
LLFKQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVECVEKDMSELVSRIADWMTMYLDENI
NFWIESQGGWEYFAEIFGRGAASEARRSREKMTRWLLVGVALLAGVLIGVGIAKRQ
>gnl|bcl2dbpro|A0A672JQE9_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Salarias fasciatus GN=BCL2L10 (length=194 residues).
MSCGLRRETLALAEDYLSLRCRSPCPAPPPPSESAAAMRHMAQDLEKQHQARFQSLAQTFLRQCGPDRCVSLRQVMEEIV
GDGHLNWGRVVSIFTFAGVVARLMLEQKDVTKGLDPGTGQELGQETVNCRALAETIAEYFGGEKKDWMLENDGWEGFCAY
ARTARQASLDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2020Legal notice