Dataset for protein BCL-2-like of organism Salarias fasciatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672GRK8_MCL1-01      MNIMSTNTKRAGLFGCLIFPQNGVMHYGSEDPTHQLPMGAGVDTLHGHVE
A0A672JQE9_BCL2L10      --------------------------------------------------
A0A672HHE5_BCL2-01      ---------------------------------MENERNRNIVVKYICHK
A0A672JL90_BCL2L1-      ----------------------------------MSSSNRELVEFFLSHR
A0A672IDC1_BCL2L1-      -----------------------------------MSENRELVVFYITYK
A0A672IDC1_BCL2L1-      -----------------------------------MSENRELVVFYITYK
                                                                          

A0A672GRK8_MCL1-01      TPKRPKNLDVAAVNGYASKNLREDSEDVDD------GSLPCTPELHSDSE
A0A672JQE9_BCL2L10      ------------------------------------MSCGLRRETLALAE
A0A672HHE5_BCL2-01      LSKRGYAWSLDAARDEDADNNGSLVDPEPTLVRRCREAAGAGPDSEDDSP
A0A672JL90_BCL2L1-      LSQRNHPSSLLRPQDARQRTE---------------------EDQASSSA
A0A672IDC1_BCL2L1-      LSQRNYPLNHIVLNEPPSRTDGGDGGDA--------GDAGSGPDQRTETH
A0A672IDC1_BCL2L1-      LSQRNYPLNHIVLNEPPSRTDGGDGGDA--------GDAGSGPDQRTETH
                                                                   :    : 

A0A672GRK8_MCL1-01      ADVSYSAAGSEVLESDTRQLLSRYFSEFTGLSKTQRGE-----SKPLSTM
A0A672JQE9_BCL2L10      DYLSLRCRSPCPAPPPP--------------------------SESAAAM
A0A672HHE5_BCL2-01      ---RLCRRPQQSDPHAA----------------------------IHRVL
A0A672JL90_BCL2L1-      SNGSVFSGSAGRSQSPR-----------------------AETDPVKSAL
A0A672IDC1_BCL2L1-      ANGTFTSRSSGSPPPSPLRQLGAGGGGGAGGGGGAGGGGGAGLDAVKEAL
A0A672IDC1_BCL2L1-      ANGTFTSRSSGSPPPSPLRQLG-------------------------EAL
                                                                        .:

A0A672GRK8_MCL1-01      KRVVEDILAKHRYAYNGMINRLSMEERGGDLRFLQSVARTLFSDGSTNWG
A0A672JQE9_BCL2L10      RHMAQDLEKQHQARFQSLAQTFLRQCGPDRCVSLRQVMEEIVGDGHLNWG
A0A672HHE5_BCL2-01      REAGDELERLYQPDFTEMSRQ-LYLTSSTAQRRFAEVIDELFRDG-VNWG
A0A672JL90_BCL2L1-      LDSADEFELLFKQAFSDLSSQ-LDITPDTAYHSFKSVMDEVFKDG-VNWG
A0A672IDC1_BCL2L1-      RDTANEFELRYSMAFSDLHSQ-LHITPATAYQSFENVMDEVFRDG-VNWG
A0A672IDC1_BCL2L1-      RDTANEFELRYSMAFSDLHSQ-LHITPATAYQSFENVMDEVFRDG-VNWG
                            :::   .   :  :               : .*   :. **  ***

A0A672GRK8_MCL1-01      RIASLVAFGAVVCQHMREQ-GRPDCVE---------------LVGQEIST
A0A672JQE9_BCL2L10      RVVSIFTFAGVVARLMLEQKDVTKGLDPGTGQELGQETVNCRALAETIAE
A0A672HHE5_BCL2-01      RIIAFFEFGGTVCVECVSKEDMTAQVD---------------NIADWMTE
A0A672JL90_BCL2L1-      RIVGLFAFGGVLCVECVEK-DMSELVS---------------RIADWMTM
A0A672IDC1_BCL2L1-      RIVGLFAFGGALCVECVEK-EMSPLVG---------------RIVEWMTV
A0A672IDC1_BCL2L1-      RIVGLFAFGGALCVECVEK-EMSPLVG---------------RIVEWMTV
                        *: .:. *...:.    .:   .  :                 : : :: 

A0A672GRK8_MCL1-01      YLLSEQRDWLIKNNSWDGFVEFFHVADPESTVR-----NTLMAVAGFAGI
A0A672JQE9_BCL2L10      YFGGEKKDWMLENDGWEGFCAYARTARQA-------SLDSSMKTALFAAA
A0A672HHE5_BCL2-01      YLNGPLDSWIRDNGGWDAFVDLYDRQRESVFSCSWPSIKTVFGLAALGAA
A0A672JL90_BCL2L1-      YLDENINFWIESQGGWEYFAEIFGRGAASEARRSREKMTRWLLVGVALLA
A0A672IDC1_BCL2L1-      YLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVT
A0A672IDC1_BCL2L1-      YLDNHIQPWIQSQGGWERFAEIFGQDAAAEGRRSEESFRKWLLVGMTVVT
                        *:      *: .:..*: *                      :  .     

A0A672GRK8_MCL1-01      GATLALLISCSGKGLKTSPRPKREEQAALVPVVQP
A0A672JQE9_BCL2L10      GVGLAGLTFLLVR----------------------
A0A672HHE5_BCL2-01      SLTIGAYLTQK------------------------
A0A672JL90_BCL2L1-      GVLIGVGIAKRQ-----------------------
A0A672IDC1_BCL2L1-      GFVVGSLFAQKRL----------------------
A0A672IDC1_BCL2L1-      GFVVGSLFAQKRL----------------------
                        .  :.                              

© 1998-2020Legal notice