Dataset for protein BCL-2-like of organism Salarias fasciatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------msenrelvvfyityklsqrnyplslivlneppsrtdg-d--d---
mnimstntkraglfgclifpqngvmhygsedptmq-------------h---k-----nh-a--d----n--g-gg-apt
                                 hmspsganvdtlhls-rtp- pknw--l-vr-yrqk-nrslvepvdd
                                  ener  gi ekfghve    ghasdvdrpqgedad l e sd e  
                                   l m         c            a a  aa   e         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :    :                                                 .:    :::   
------gsagsgpdqrteshangsltsrssgspppsp----------------------------vksalrdtanefelr
lvrrcr-d----retlsdte---tfsrgpqqvsqsptlrqlgrygsggtglsktqrggggagtsp--evmlrvvddllrl
      m-lplte shdsapsyvryrcagperlehdrrql sagfgefa ggggag e   eldkslrt khsgq i kq
      eac cr  leal addl vfa  acpd  aa                           epha   em e   ak
          a    a         c      a                               aia     a       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   :  :               : .*   :. **  ****: .:. *...:.    .:   .  :              
ysmafsdlssq-lhitpatayrsfesVmdevfrDG-vNWGRivglfaFggvvcvecvek-dmsplvg-------------
hqyrytsmhrtlsyqessgrqqrlrn irtlvs  st    visivt aaalarlmrsqkevtkqldpgtgqelgqetvn
frqd qg iqrf rlcrpddlvf qq ae i k  hl     aaf e   t  qh l  egrpeg s             
 kp  ne an   me gg  ch  ke      g                              dc e             
  a          d   d      a                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   : : :: *:      *: .:..*: *                      :  .     .  :.               
--riaewmtvYldnhiqpWiqsqggWerFaeifgrdaaaegrrs-esfrtwllvgmtvvagvvvgsliaqkr--------
crnvvdtise fngeqrd mrknns dg vdyyrqarqs-----e---tkvmktavfaatsftlavyftls-lglktspr
  llgqe at  lsplns lle   y calahvqdpevtvc wpkmnssfgl lllli lli lgtskrvr       
  a      m  genkkf  id     a   f dtg e sfs  r  lkrl  gagg  ag  g lfclqk       
                d   e                   a      id      a         a     g        

       330     
....:....|....:
               
---------------
pkreeqaalvpvvqp
               
               
               
© 1998-2020Legal notice