Dataset for protein Mcl-1 of organism Rhinolophus ferrumequinum

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A671G0G2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=347 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARP
SPIGAESPDVTATPARRLFFAPSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEEASNGPGMSGS
LPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWRMPARQ
VHFEAEEQDTGPKSWPKLSSEQYCCSC
>gnl|bcl2dbpro|A0A671G0G2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=352 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAGGGEAGAVIGGSAGASPPATLAPDARRVARP
SPIGAESPDVTATPARRLFFAPSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEEASNGPGMSGS
LPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEF
FHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A671G0G2_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=MCL-1 (length=198 residues).
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice