Dataset for protein Mcl-1 of organism Rhinolophus ferrumequinum

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************                                           
MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLaagkeatarreagggeagaviggsagasppatlapdarrvarp
                                     -------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spigaespdvtatparrlffapsfrasplkemeapaadaimspeeeldgyepeplgkrpavlpllerveeasngpgmsgs
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               *************************************************
lpstpppaeeeeedelyrqsleiisrylreqATGAKDAKPMGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIK
-------------------------------                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************************   .  
NEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW--dgfv
                                                                          rmparq

       330       340       350    
....:....|....:....|....:....|....
 .* .*: : * ..     :     ..       
efFhvEdlegGirnvllafagvagvgaglaylir
vh ea eqdt pkswpklsseqyccsc-------
© 1998-2020Legal notice