Dataset for protein Mcl-1 of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671G0G2_MCL1-03      MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLL-------------
A0A671G0G2_MCL1-01      MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAG
A0A671G0G2_MCL1-02      MLGLKRNAVIGLNLYCGGSGLGAGSGGSASPSGERLLAAGKEATARREAG
                        *************************************             

A0A671G0G2_MCL1-03      --------------------------------------------------
A0A671G0G2_MCL1-01      GGEAGAVIGGSAGASPPATLAPDARRVARPSPIGAESPDVTATPARRLFF
A0A671G0G2_MCL1-02      GGEAGAVIGGSAGASPPATLAPDARRVARPSPIGAESPDVTATPARRLFF
                                                                          

A0A671G0G2_MCL1-03      --------------------------------------------------
A0A671G0G2_MCL1-01      APSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEE
A0A671G0G2_MCL1-02      APSFRASPLKEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLERVEE
                                                                          

A0A671G0G2_MCL1-03      -----------------------------------------ATGAKDAKP
A0A671G0G2_MCL1-01      ASNGPGMSGSLPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKP
A0A671G0G2_MCL1-02      ASNGPGMSGSLPSTPPPAEEEEEDELYRQSLEIISRYLREQATGAKDAKP
                                                                 *********

A0A671G0G2_MCL1-03      MGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSR
A0A671G0G2_MCL1-01      MGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSR
A0A671G0G2_MCL1-02      MGRSASASRKALDTLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSR
                        **************************************************

A0A671G0G2_MCL1-03      VMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
A0A671G0G2_MCL1-01      VMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
A0A671G0G2_MCL1-02      VMIHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
                        **************************************************

A0A671G0G2_MCL1-03      VRTKRDWLVKQRGW--DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLA
A0A671G0G2_MCL1-01      VRTKRDWLVKQRGWRMPARQVHFEAEEQDTGPKSWPKLSSEQYCCSC---
A0A671G0G2_MCL1-02      VRTKRDWLVKQRGW--DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLA
                        **************   .   .* .*: : * ..     :     ..   

A0A671G0G2_MCL1-03      YLIR
A0A671G0G2_MCL1-01      ----
A0A671G0G2_MCL1-02      YLIR
                            

© 1998-2020Legal notice