Dataset for protein BCL-2-like of organism Pseudonaja textilis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A670YDS2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL2A1 (length=173 residues).
MESYNFLYVNTLVQDYLKYICQEAQLAAAPNKVAEVLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIFHQVMENEFA
DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFITDYIVSTKGKWISENGGWDNGFITKFEDRNSWVSLSTLKTK
ILAVFSIFNQYHS
>gnl|bcl2dbpro|A0A670Z5Q4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pseudonaja textilis GN=MCL-1 (length=184 residues).
CESIRLQQKGNCTLYCGGGGGNLAGRSPSPHLQEMTRQNQDTFVPSLTFCGALPKVLPSLLNSGMLRKVQIDKADDLKLM
SEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHNAWEGFVKFFHVEDLEG
SIRNILVAFAGVAGLGASLAYLIR
>gnl|bcl2dbpro|A0A670Z9Y4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL2L1 (length=197 residues).
MSSGNRSLVVDFIAYKLAQRGHSWREIEGDGEERTELSGEMGSGSGGVLNGGSPSWHPSPSPVVNGAASIHPALLEELSD
GPQEAVRQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMR
GLVGRIATWMATYLTEHLDPWIQDNGGWVSLGLNLQG
>gnl|bcl2dbpro|A0A670ZV01_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL-2 (length=222 residues).
MMAHPGIRDYSNREIVLRYIHYKLSQKGYDWVASGDRENVSPAVGTFPALGGLVPLPSAAVSNLAATEEHPVPQVVYSTL
CQAGDEFSRRYQRDFTQMSGQLHLTPVTARSHFMAVVEELFRDGVNWGRIVAFFEFGGMLCVESVSREMSPLVDSIAEWM
TEYMNRHLHNWIQDNGGWDAFVELYSNNIRPLFDLSWLPLKTILSLAVVGACITLGAYLGHK
© 1998-2020Legal notice