Dataset for protein BCL-2-like of organism Pseudonaja textilis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670YDS2_BCL2A1-      -------------------------MESYNFLYVN---------------
A0A670Z5Q4_MCL1-01      ------------------CESIRLQQKGNCTLYCGGGGGNLAGRS-----
A0A670Z9Y4_BCL2L1-      -------MSSGNRSLVVDFIAYKLAQRGHSWREIEGDGEERTELSGEMGS
A0A670ZV01_BCL2-01      MMAHPGIRDYSNREIVLRYIHYKLSQKGYDWVA-SGDRENVSPAVGTF--
                                                   .                      

A0A670YDS2_BCL2A1-      -------------------------TLVQDYLKYICQEAQLAAAPNKVAE
A0A670Z5Q4_MCL1-01      ---------------------------PSPHLQEMTRQNQ-DTFVP----
A0A670Z9Y4_BCL2L1-      GSGGVLNGGSPSWHPSPSPVVNGAASIHPALLEELSDGPQ-EAVRQ----
A0A670ZV01_BCL2-01      ------------------PALGGLVPLPSAAVSNLAATEE-HPVPQVVYS
                                                       :. :    :  .       

A0A670YDS2_BCL2A1-      VLRKAGSSAQKEVEGNLRPYVDSLGIHSIEEAGNIFHQVMENEFADGKIN
A0A670Z5Q4_MCL1-01      SLTFCGALPKVLPSLLNSGMLRKVQIDKADDL-KLMSEVATQVFNDGITN
A0A670Z9Y4_BCL2L1-      TLREAGDEFELRYRRAFSDLTSQLHITLGTAY-QSFEQVVNELFRDGV-N
A0A670ZV01_BCL2-01      TLCQAGDEFSRRYQRDFTQMSGQLHLTPVTAR-SHFMAVVEELFRDGV-N
                         *  .*   .            .: :       . :  *  : * **  *

A0A670YDS2_BCL2A1-      WGRILTIFLFGGILAKKLQGPLAKENLKQISYFITDYIVSTKGKWISENG
A0A670Z5Q4_MCL1-01      WGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHN
A0A670Z9Y4_BCL2L1-      WGRIVAFFSFGGALCVESVDKEMRGLVGRIATWMATYLTEHLDPWIQDNG
A0A670ZV01_BCL2-01      WGRIVAFFEFGGMLCVESVSREMSPLVDSIAEWMTEYMNRHLHNWIQDNG
                        ****:::: **. :.    .      :  ::  ::  :      *:  :.

A0A670YDS2_BCL2A1-      GWDNGFITKFEDRNSWVSLSTLKTKILAVFSIFNQYHS----------
A0A670Z5Q4_MCL1-01      AWEGFVK--------FFHVEDLEGSIRNILVAFAGVAGLGASLAYLIR
A0A670Z9Y4_BCL2L1-      GW----------------------------------VSLGLNLQG---
A0A670ZV01_BCL2-01      GWDAFVELYSNNIRPLFDLSWLPLKTILSLAVVGACITLGAYLGHK--
                        .*                                              

© 1998-2020Legal notice