Dataset for protein BCL-2-like of organism Pseudonaja textilis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
-------------------i-ykl-qkgyswly-sgdgen----s-------------------------------lpsa
mmahpgirsysnrslvvry-s---smrsnntvevn-----vtpr-gtmgsgsggvlnggspswhpspspvvnglvt-vqp
       mdsg  ei ldfehir q e hdfraig grgersglv ef                     alg aasihpd
                  c a   a    c   ce     laea                               p    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :. :    :  .        *  .*   .            .: :       . :  *  : * **  *****:::: *
ylseltrtpq-havpq----tLrqaGdefsvrysrnfsqmvsqlhitsvtay-ssfsqVveelFrDGv-NWGRIvtffsF
lvqymsqqneletfvpvvysv tkc sspqrlvrllntpytrsvqlhpieergqlmme mtqv n  kt     lalil 
h knicdge  dparnk aes cf  alaklepqgdlrglsgk g dlgddl ni ha anne a  ii       i e 
a e  aaea  a           e     ek  e a  d ld     ka  a kh                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. :.    .      :  ::  ::  :      *:  :..*                                      
GgmlcvesvsremsslvstiaewmteylvthlrpWiqdnggWd-fv----------f-ls-l--ki---l--f---vslg
 aivakklqgpnqrpnlkslsyiiatvmtstkhn lshhna -n--ktysnnrrsw-s--w-pt--rnv-vv-nqyit--
  f   h kdklakggigr  tf  inre gk  le    eggfilkfedinplvhvet klstllsfsivggvhg  
  a       i  ee  dq          e  de         a  e        f d  d eg  iai aa aaca   

        
....:...
        
a-l-----
-y-qylir
ls ghk  
 n ag   
© 1998-2020Legal notice