Dataset for protein BCL-2-like of organism Physeter macrocephalus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A2Y9EFA3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2Y9EML1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL-2 (length=230 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAGGPALSPV
PPVVHLTLRQAGDDFSHRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPL
VDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
>gnl|bcl2dbpro|A0A2Y9FIV6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2Y9FP79_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2A1 (length=175 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKHLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITENTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKICEILRLLKQYY
>gnl|bcl2dbpro|A0A2Y9S808_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Physeter macrocephalus GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPGSDSGASPPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPTRLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCEPEPLGKRPAVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLQEQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2Y9S808_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Physeter macrocephalus GN=MCL-1 (length=198 residues).
MFGLKRNAVIGLNLYCGGAGLGPGSDSGASPPGRRLLATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice