Dataset for protein BCL-2-like of organism Physeter macrocephalus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      :  .            .      .                                  
--------------v--f-myklsqngyi--wl---gaglgpgsdsgasp------------------------------
mmhtprtsydnrel-vd-vyfgmkrkavvgln-ycgdvdsnrtetprv--pgrrllsagtrtpapsrvsgpavrtatggs
 aaagasgqst mtdskylsih rard sky-sqis-p eagsks egtespmitsatpnkntswrltgsgpsqkvpahg
      map   ai me ih   q  l  v  fpqc d  aag a d adgefp qikgdakglggdpaepng i   
               a  gg        e          a    a   a          gea   hea    age     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sslspvpvvppdarrvarpspigaegpdvtatptrllffaptrrasppeemessasdaimspeeeldgcepeplgkrpav
pgpdaretlama                                                                    
aa   papi                                                                       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       .   . : .
--------------------------------------------------------------------vlqtlrrvgdev
lpllelvgeasnspgkdgslpstpppaeeeedelyrqsleiisrylqeqatgtkdakplggsgaasrklheamfsaqngf
                                                                    aqlva q   d 
                                                                     kd   e     
                                                                          a     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. .    :  :     :.       :  *    * .*  ****:*::: * . :     .      :     :   :.  
erryrrafsgmlsqlhitpgtavqsfsqVmvelFsdG-vNWGRiVtffsFggflckesvskemeplve---piaewmtey
qtnhettlqdltrk-dvkneddrkrltr vehv rg vt    l aliv eaavavhlkninqsscidtykrlsysiadv
slhlkpd dnisv- -lsifs yti nt snre q  ip       i e   vmiak lgrriqvd s   qvqlfvvtf
 k f  c ae da      d  qg    d   e             a   i      dg  a   g   n  a   
 h         a                                                         e        

       330       340       350       360       370       380        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
:      *: .. **   *.  :                               :             
lvrtlrdWivkngGWd-gFvelygvedl----------eggwrsvllvltgva-vga-v-lglyylik
inthkht lqsqr  ent tdffhpsa-eesrkgrrlf---iln-rwafalavgl--l-t-kaaf--r
 tertgp  rqs   a e  kk ennsaa a   qprrnfs---lktltskmteiagvrlv sllss-
 edn ee  h     a    dkm        e  d n atf ef g ila   c    qf gr 
     a                 g                    a     c            ah 
© 1998-2020Legal notice