Dataset for protein BCL-2-like of organism Physeter macrocephalus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9S808_MCL1-01      -------------------MFGLKRNAVIGLNLYCGGAGLGPGSDSGASP
A0A2Y9FP79_BCL2A1-      ------------MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRV--
A0A2Y9EML1_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYE--W----DAGDAGAASPGAAP
A0A2Y9FIV6_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYS--WSQFSDVDENRTEAPEGTE
A0A2Y9EFA3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYV--------CGAGPGEGPAADP
A0A2Y9S808_MCL1-02      -------------------MFGLKRNAVIGLNLYCGGAGLGPGSDSGASP
                                              :  .            .      .    

A0A2Y9S808_MCL1-01      PGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARPS
A0A2Y9FP79_BCL2A1-      --------------------------------------------------
A0A2Y9EML1_BCL2-01      APGIFSSQPGRTPAPSRTSPPPPQTAPAGGPALSPVPPV-----------
A0A2Y9FIV6_BCL2L1-      SDMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAA-------
A0A2Y9EFA3_BCL2L2-      --------------------------------------------------
A0A2Y9S808_MCL1-02      PGRRLLATGTKDAKPLGGSGAASRK-------------------------
                                                                          

A0A2Y9S808_MCL1-01      PIGAEGPDVTATPTRLLFFAPTRRASPPEEMESSASDAIMSPEEELDGCE
A0A2Y9FP79_BCL2A1-      --------------------------------------------------
A0A2Y9EML1_BCL2-01      --------------------------------------------------
A0A2Y9FIV6_BCL2L1-      --------------------------------------------------
A0A2Y9EFA3_BCL2L2-      --------------------------------------------------
A0A2Y9S808_MCL1-02      --------------------------------------------------
                                                                          

A0A2Y9S808_MCL1-01      PEPLGKRPAVLPLLELVGEASNSPGKDGSLPSTPPPAEEEEDELYRQSLE
A0A2Y9FP79_BCL2A1-      --------------------------------------------------
A0A2Y9EML1_BCL2-01      --------------------------------------------------
A0A2Y9FIV6_BCL2L1-      --------------------------------------------------
A0A2Y9EFA3_BCL2L2-      --------------------------------------------------
A0A2Y9S808_MCL1-02      --------------------------------------------------
                                                                          

A0A2Y9S808_MCL1-01      IISRYLQEQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQG
A0A2Y9FP79_BCL2A1-      ----------------------------LQDVAFSVQNEVEKHLKPCLDN
A0A2Y9EML1_BCL2-01      ----------------------------VHLTLRQAGDDFSHRYRRDFAE
A0A2Y9FIV6_BCL2L1-      ----------------------------VKQALREAGDEFELRYRRAFSD
A0A2Y9EFA3_BCL2L2-      ----------------------------LHQAMRAAGDEFETRFRRTFSD
A0A2Y9S808_MCL1-02      ----------------------------ALETLRRVGDGVQRNHETAFQG
                                                       .   . : .. .    :  

A0A2Y9S808_MCL1-01      MLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKS
A0A2Y9FP79_BCL2A1-      IDV---VSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILIKKLLG
A0A2Y9EML1_BCL2-01      MSSQLHLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVN
A0A2Y9FIV6_BCL2L1-      LTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVD
A0A2Y9EFA3_BCL2L2-      LAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAESVN
A0A2Y9S808_MCL1-02      MLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKS
                        :     :.       :  *    * .*  ****:*::: * . :     .

A0A2Y9S808_MCL1-01      INQESCIE---PLAESITDVLVRTKRDWLVKQRGWD-GFVDFFHVEDL--
A0A2Y9FP79_BCL2A1-      GRIAPDVDTYKEISYFVAEFITENTGEWIRQNGGWENGFVKKFEPKS---
A0A2Y9EML1_BCL2-01      REMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM---
A0A2Y9FIV6_BCL2L1-      KEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAE
A0A2Y9EFA3_BCL2L2-      KEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGALEE
A0A2Y9S808_MCL1-02      INQESCIE---PLAESITDVLVRTKRDWLVKQRGWD-GFVDFFHVEDL--
                              :     :   :.  :      *: .. **   *.  :       

A0A2Y9S808_MCL1-01      --------EGGIRNVLLAFAGVAGVGA----GLAYLIR
A0A2Y9FP79_BCL2A1-      ----------GWLTFLEVTGKICEI--LRLLKQYY---
A0A2Y9EML1_BCL2-01      ----RPLFDFSWLSLKALLSLAL-VGACVTLGAYLGHK
A0A2Y9FIV6_BCL2L1-      SRKGQERFN------RWFLTGMT-VAGVVLLGSLFSRK
A0A2Y9EFA3_BCL2L2-      A---RRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A2Y9S808_MCL1-02      --------EGGIRNVLLAFAGVAGVGA----GLAYLIR
                                                :             

© 1998-2020Legal notice