Dataset for protein BCL-2-like of organism Panthera tigris altaica

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C9J3S1_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C9J3W6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL-2 (length=166 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAXXXXXXXXXXAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDF
AEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDN
GGWVGA
>gnl|bcl2dbpro|A0A8C9K7H4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Panthera tigris altaica GN=MCL-1 (length=190 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C9KZ34_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2A1 (length=174 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVLSLLKNYY
>gnl|bcl2dbpro|A0A8C9KZ34_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2A1 (length=164 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWRRFRSVKHKQRGDRTSLSLSH
PLLR
>gnl|bcl2dbpro|A0A8C9M2S8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Panthera tigris altaica GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice