Dataset for protein BCL-2-like of organism Panthera tigris altaica

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9M2S8_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A8C9J3S1_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGA------------------
A0A8C9K7H4_MCL1-01      ----------MFGLKRNAVIGLNLYCGGAGLAAGSGGASATGAKDAKPLG
A0A8C9J3W6_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAXXXXXXXXXXAAAAA
A0A8C9KZ34_BCL2A1-      -MADGEFGY-VLTLARDYTKHVLQ--------------------------
A0A8C9KZ34_BCL2A1-      -MADGEFGY-VLTLARDYTKHVLQ--------------------------
                                     :  .                                 

A0A8C9M2S8_BCL2L1-      METPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAG
A0A8C9J3S1_BCL2L2-      GPGEGPAA-------------------------------DPLHQAMRAAG
A0A8C9K7H4_MCL1-01      GS--GAAS-------------------------------RKALETLRRVG
A0A8C9J3W6_BCL2-01      GPALSPVP-------------------------------PVVHLTLRQAG
A0A8C9KZ34_BCL2A1-      GPQPGCHP-------------------------------SRVSQVLQDVA
A0A8C9KZ34_BCL2A1-      GPQPGCHP-------------------------------SRVSQVLQDVA
                            .                                       .:. ..

A0A8C9M2S8_BCL2L1-      DEFELRYRRAFSDLTSQLHITPG-TAYQSFEQVVNELFRDG-VNWGRIVA
A0A8C9J3S1_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPG-SAQQRFTQVSDELFQGG-PNWGRLVA
A0A8C9K7H4_MCL1-01      DGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVT
A0A8C9J3W6_BCL2-01      DDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVEELFRDG-VNWGRIVA
A0A8C9KZ34_BCL2A1-      FSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFEDGIINWGRIVT
A0A8C9KZ34_BCL2A1-      FSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFEDGIINWGRIVT
                          ..      :     :: :     .   :  *    * .*  ****:*:

A0A8C9M2S8_BCL2L1-      FFSFGGALCVESVDKEMQVLVS--RIATWMATYLNDHLEPWIQENGGWDT
A0A8C9J3S1_BCL2L2-      FFVFGAALCAESVNKEMEPLVG--QVQEWMVAYLETRLADWIHSSGGWAE
A0A8C9K7H4_MCL1-01      LISFGAFVAKHLKSINQESCIE--PLAESITDVLVRTKRDWLVKQRGWDG
A0A8C9J3W6_BCL2-01      FFEFGGVMCVESVNREMSPLVD--NIALWMTEYLNRHLHTWIQDNGGWVG
A0A8C9KZ34_BCL2A1-      IFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWEN
A0A8C9KZ34_BCL2A1-      IFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWRR
                        :: * . :     .           :   :.  :      *: .. **  

A0A8C9M2S8_BCL2L1-      FVELYGNNAAAESRKGQ----ERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8C9J3S1_BCL2L2-      FTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A8C9K7H4_MCL1-01      FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR-----------
A0A8C9J3W6_BCL2-01      --A--------------------------------------------
A0A8C9KZ34_BCL2A1-      --GFVRKFEPKSGWLTFLEVTGKICKVLSLLKNYY------------
A0A8C9KZ34_BCL2A1-      ---FRSVKHKQRGDRTSLSLSHPLLR---------------------
                                                                       

© 1998-2022Legal notice