Dataset for protein BCL-2-like of organism Panthera tigris altaica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :  .                                     .                         
-ma-g-fgy-vrtlvrdyvkyklsq-gy---a------------------gpqpgphp----------------------
m--d-e---dnleiavnftshvnq-k--vws-gssxxxxxtxaxxatpsgms--scasgnpswhladspavngatghsss
 ahtprtsqstfg kmkaligl ryr gsglqfgdvgesrxgxpegkele etl avn                      
   a asap m a  a  ih   l c  ecg adageana e kd aaaa  ge  ia                      
      m            g        a d                     a                           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .:. ..  ..      :     :: :     .   :  *    * .*  ****:*::: * . :  
---------srvsqvlrdvgdsvqrryrrqfspmlsqlhvtpv-tartrfhqVmeelFrdG-vNWGRiVtffsFggilck
ldarevipmrvlhltmqraafefegevekalkdltdkfdigsgdsvyqmltt vvke eg ii    l aiia eaaviv
         ppalea  q   g stnh tt qgcsr   lknf d qs- sr snhv s  vt       l v   vmaa
         dk k    e   d  l f  d ae aa      e   kgs   d   q   p         e   f   
         aa      a                                                            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .           :   :.  :      *: .. **                                          
esvqkemvplvd--kvaywmaeyltrhlgeWirqngGWdg--efygv-aleegrrt-l---a-v-rv-------------
kllnerievdasafrisefvttfinkttrd lqssr  vtfval---n--------v-svw-s-r--ltglvylyrvvtv
h ksrnqsscig  qlqtsivdv vtrkht  vkq   rr t--vsnkhpqsswlnselnthrlntwgstgmtyigl ll
   di  q   e  p  l    ed  ep  h   en  g rrkgekkraiklr glsgpilk fllaknvga    
              n             a       ae    fhdfdaag d gq eafekfcg  a  aa a     
                                               e        f     g a               

       
....:..
       
-------
gslfssk
 af ar 
       
       
       
© 1998-2022Legal notice