Dataset for protein Bfl1 of organism Panthera leo

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C8X938_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Panthera leo GN=BCL2A1 (length=202 residues).
MAAATAVSSAKRSLRAELKQRLRAMSAEERLRQSQLLAQKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCF
VPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEALSTGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTR
CLQQRDSKPYTVALAFREQMCLRVPVDEHDVRVDEVLYEDST
>gnl|bcl2dbpro|A0A8C8X938_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Panthera leo GN=BCL2A1 (length=327 residues).
MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEKQLKPCLDKFHVGSVDTARTMFHQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPKSGWLTFLEVT
GKICKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQP
GEDEVREEALSTGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVALAFREQMCLRVPVDEHDVRVDE
VLYEDST
© 1998-2022Legal notice