Dataset for protein Bfl1 of organism Panthera leo

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8X938_BCL2A1-      ------------------------------MAAATAVSSAKRSLRAELKQ
A0A8C8X938_BCL2A1-      MADGEFGYVLTLARDYTKHVLQGPQPGCHPSRVSQVLQDVAFSVQGEVEK
                                                        .: .:...  *:..*:::

A0A8C8X938_BCL2A1-      RL------------------------------------------------
A0A8C8X938_BCL2A1-      QLKPCLDKFHVGSVDTARTMFHQVMEKEFEDGIINWGRIVTIFAFEGILI
                        .*                                                

A0A8C8X938_BCL2A1-      ------RAMSAEERLRQSQLLAQ---------------------------
A0A8C8X938_BCL2A1-      KKLLQERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGWENGFVRKFEPK
                              * :.  : :. * ::*:                           

A0A8C8X938_BCL2A1-      --------------KVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQ
A0A8C8X938_BCL2A1-      SGWLTFLEVTGKICKVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQ
                                      ************************************

A0A8C8X938_BCL2A1-      GKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEAL
A0A8C8X938_BCL2A1-      GKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQPGEDEVREEAL
                        **************************************************

A0A8C8X938_BCL2A1-      STGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVALA
A0A8C8X938_BCL2A1-      STGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVALA
                        **************************************************

A0A8C8X938_BCL2A1-      FREQMCLRVPVDEHDVRVDEVLYEDST
A0A8C8X938_BCL2A1-      FREQMCLRVPVDEHDVRVDEVLYEDST
                        ***************************

© 1998-2022Legal notice