Dataset for protein Bfl1 of organism Panthera leo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                .: .:...  *:..*:::.*                            
------------------------------srvstvvssvkrSvrgEvkqrL----------------------------
madgefgyvltlardytkhvlqgpqpgchpmaaaqalqdaaf lqa lekq kpcldkfhvgsvdtartmfhqvmekefe

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          * :.  : :. * ::*:                                     
--------------------------RivsdeerlrvSylvAq-------------------------------------
dgiinwgrivtifafegilikkllqe ampaadafkq qfl efitkhtgewirqnggwengfvrkfepksgwltflevt

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ****************************************************************************
----KVIAHSQYQKSKRISIFLSMPDEVETEEIIRDIFRQGKTCFVPRYRFQNNHMDMLRLTSPDEISLLPRTSWNILQP
gkic                                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GEDEVREEALSTGGLDLIFVPGLGFDKHGNRLGRGKGYYDSYLTRCLQQRDSKPYTVALAFREQMCLRVPVDEHDVRVDE
                                                                                

       
....:..
*******
VLYEDST
       
© 1998-2022Legal notice