Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A2I3RTV4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2I3RTV4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|G2HFR3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Pan troglodytes GN=MCL-1 (length=147 residues).
MDICRLSAAMREFYIVHLDIYPPPECTIHMLLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQ
ESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|H2Q805_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|H2Q805_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|H2Q9G4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L10 (length=204 residues).
MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVAL
MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGFQPRLNEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL
>gnl|bcl2dbpro|H2QEM8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Pan troglodytes GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2020Legal notice