Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          -----------------------------MAHAGRTGYDNR---EIVMKY
H2Q805_BCL2L2-02        MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
H2Q805_BCL2L2-04        ----MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---G-----
H2Q805_BCL2L2-03        ----MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---G-----
A0A2I3RTV4_MCL1-01      --MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGRLLA
A0A2I3RTV4_MCL1-02      --MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGRLLA
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          IHYKLSQRGYEWDAGDVGAAPPGAA-------------------------
H2Q805_BCL2L2-02        DEFETRFRR-TFSDLAAQLHVTPGSAQQRFTQVSDELFQGG---------
H2Q805_BCL2L2-04        ------------AGGEAGEGAPGGAGDYGNGLESEELEPED---------
H2Q805_BCL2L2-03        ------------AGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEP
A0A2I3RTV4_MCL1-01      TEKEASARR-EIGGGEAGAVIGGSAG----ASPPSTLTPDS-RRVARPPP
A0A2I3RTV4_MCL1-02      TEKEASARR-EIGGGEAGAVIGGSAG----ASPPSTLTPDS-RRVARPPP
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          ------------------------------------------------PA
H2Q805_BCL2L2-02        -----PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLA
H2Q805_BCL2L2-04        ---------------------------QEEEEEPGLV--------EGDPG
H2Q805_BCL2L2-03        EPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLV--------EGDPG
A0A2I3RTV4_MCL1-01      IGAEVPDVTATPARLLFFAPTRRAAPLEEMEA----------------PA
A0A2I3RTV4_MCL1-02      IGAEVPDVTATPARLLFFAPTRRAAPLEEMEA----------------PA
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------MATPASAPDTRA
A0A2I3RA26_BCL2A1-      ---------------------------------------MTDCEFGYIYR
A0A2I3RA26_BCL2A1-      ---------------------------------------MTDCEFGYIYR
A0A2I3RA26_BCL2A1-      ---------------------------------------MTDCEFGYIYR
H2Q9G4_BCL2L10-01       ----------------------------------------------MVDQ
A0A2I3RTV4_MCL1-03      ----------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGR
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          PGIFSSQ----PGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPP
H2Q805_BCL2L2-02        DWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
H2Q805_BCL2L2-04        DGAIEDP--ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
H2Q805_BCL2L2-03        DGAIEDP--ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
A0A2I3RTV4_MCL1-01      ADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPP
A0A2I3RTV4_MCL1-02      ADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPP
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        LVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETR------
A0A2I3RA26_BCL2A1-      LAQDYLQYVLQI--------PQPGSGPSKTSRVLQNVAFSVQKE------
A0A2I3RA26_BCL2A1-      LAQDYLQYVLQI--------PQPGSGPSKTSRVLQNVAFSVQKE------
A0A2I3RA26_BCL2A1-      LAQDYLQYVLQI--------PQPGSGPSKTSRVLQNVAFSVQKE------
H2Q9G4_BCL2L10-01       WRERTTMADPLR--------ERTERLLADYLGYCAREPGTPEPT------
A0A2I3RTV4_MCL1-03      LLATGAKDTKPM--------GRSGATSRKALETLRRVGDGVQRN------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          ------------------------MDICRLSAAMREFYIVHLDI------
H2QEM8_BCL2-01          VV-----------------HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
H2Q805_BCL2L2-02        VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
H2Q805_BCL2L2-04        VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
H2Q805_BCL2L2-03        VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
A0A2I3RTV4_MCL1-01      PAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRR
A0A2I3RTV4_MCL1-02      PAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRR
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        ------------------------FRRTFSDLAAQLHVTPGSAQQRFTQV
A0A2I3RA26_BCL2A1-      ------------------------VEKNLKSCLDNVNVVSVDTARTLFNQ
A0A2I3RA26_BCL2A1-      ------------------------VEKNLKSCLDNVNVVSVDTARTLFNQ
A0A2I3RA26_BCL2A1-      ------------------------VEKNLKSCLDNVNVVSVDTARTLFNQ
H2Q9G4_BCL2L10-01       ------------------------PSTPEAAVLRSAAARLRQIHRSFFSA
A0A2I3RTV4_MCL1-03      ------------------------HETAFQGMLRKLDIKNEDDVKSLSRV
A0A2I3RTV4_MCL1-04      --------------------------SVETCMLRKLDIKNEDDVKSLSRV
G2HFR3_MCL1-01          ------------------------YPPPECTIHMLLDIKNEDDVKSLSRV
H2QEM8_BCL2-01          TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE------SVNREMSP
H2Q805_BCL2L2-02        SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRP
H2Q805_BCL2L2-04        SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRP
H2Q805_BCL2L2-03        SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRP
A0A2I3RTV4_MCL1-01      VG-------------DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRV
A0A2I3RTV4_MCL1-02      VG-------------DGVQRN---HETAFQGWVCGV--------------
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q805_BCL2L2-01        ----------SDELFQGG-------PNWGRLVAFFVF-------GAALCA
A0A2I3RA26_BCL2A1-      V---------MEKEFEDGI------INWGRIVTIFAF-------EGILIK
A0A2I3RA26_BCL2A1-      V---------MEKEFEDGI------INWGRIVTIFAF-------EGILIK
A0A2I3RA26_BCL2A1-      V---------MEKEFEDGI------INWGRIVTIFAF-------EGILIK
H2Q9G4_BCL2L10-01       YLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTT
A0A2I3RTV4_MCL1-03      ----------MIHVFSDGV------TNWGRIVTLISF-------GAFVAK
A0A2I3RTV4_MCL1-04      ----------MIHVFSDGV------TNWGRIVTLISF-------GAFVAK
G2HFR3_MCL1-01          ----------MIHVFSDGV------TNWGRIVTLISF-------GAFVAK
H2QEM8_BCL2-01          ----------LVDNIALWM------TEYLNRHL-----------------
H2Q805_BCL2L2-02        ----------GISTTDRGF------PRARYRARTTNY-------NSSRSR
H2Q805_BCL2L2-04        ----------GISTTDRGF------PRARYRARTTNY-------NSSRSR
H2Q805_BCL2L2-03        ----------GISTTDRGF------PRARYRARTTNY-------NSSRSR
A0A2I3RTV4_MCL1-01      ----------MIHVFSDGV------TNWGRIVTLISF-------GAFVAK
A0A2I3RTV4_MCL1-02      -------------LPCRGP------RRW----------------------
                                                                          

A0A2I3RA26_BCL2A1-      -----------------------------------VARSWLTAASTSTAQ
H2Q805_BCL2L2-01        ESVNKEMEPLV-----------GQVQEWMVAYLETRLADWIHSSGGWA--
A0A2I3RA26_BCL2A1-      KLLRQQIAPDVDTY--------KEISYFVAEFIMNNTGEWIRQNGGWGKW
A0A2I3RA26_BCL2A1-      KLLRQQIAPDVDTY--------KEISYFVAEFIMNNTGEWIRQNGGWEN-
A0A2I3RA26_BCL2A1-      KLLRQQIAPDVDTY--------KEISYFVAEFIMNNTGEWIRQNGGWEN-
H2Q9G4_BCL2L10-01       RWKKWGFQPRLNEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWD--
A0A2I3RTV4_MCL1-03      HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD--
A0A2I3RTV4_MCL1-04      HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD--
G2HFR3_MCL1-01          HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD--
H2QEM8_BCL2-01          -------------------------------------HTWIQDNGGWD--
H2Q805_BCL2L2-02        FYSGFNSRPRG-----------RVYRGRARA------TSWYSPY------
H2Q805_BCL2L2-04        FYSGFNSRPRG-----------RVYRGRARA------TSWYSPY------
H2Q805_BCL2L2-03        FYSGFNSRPRG-----------RVYRGRARA------TSWYSPY------
A0A2I3RTV4_MCL1-01      HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD--
A0A2I3RTV4_MCL1-02      ------HQECA-----------AGFCRCCWS------RSWF---------
                                                               *          

A0A2I3RA26_BCL2A1-      EN---GFVKKFEH-------KSGWMTFLEVTGKISILLTRKDTPYCETGL
H2Q805_BCL2L2-01        -----EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFF
A0A2I3RA26_BCL2A1-      HNHTPMLVESVAH-------KKRKMAL-----------------------
A0A2I3RA26_BCL2A1-      -----GFVKKFEH-------KSGWMTFLEVTGKICEMLSLLKQ-YC----
A0A2I3RA26_BCL2A1-      -----GFVKKFEH-------KSGWMTFLEVTGKISILLTRKDTPYCETGL
H2Q9G4_BCL2L10-01       -----GFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL-----
A0A2I3RTV4_MCL1-03      -----GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------
A0A2I3RTV4_MCL1-04      -----GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------
G2HFR3_MCL1-01          -----GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------
H2QEM8_BCL2-01          -----AFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK--
H2Q805_BCL2L2-02        --------------------------------------------------
H2Q805_BCL2L2-04        --------------------------------------------------
H2Q805_BCL2L2-03        --------------------------------------------------
A0A2I3RTV4_MCL1-01      -----GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR--------
A0A2I3RTV4_MCL1-02      -------------------------------GISNKIALL----------
                                                                          

A0A2I3RA26_BCL2A1-      IFLTVMETIANTYFYF
H2Q805_BCL2L2-01        ASK-------------
A0A2I3RA26_BCL2A1-      ----------------
A0A2I3RA26_BCL2A1-      ----------------
A0A2I3RA26_BCL2A1-      IFLTVMETIANTYFYF
H2Q9G4_BCL2L10-01       ----------------
A0A2I3RTV4_MCL1-03      ----------------
A0A2I3RTV4_MCL1-04      ----------------
G2HFR3_MCL1-01          ----------------
H2QEM8_BCL2-01          ----------------
H2Q805_BCL2L2-02        ----------------
H2Q805_BCL2L2-04        ----------------
H2Q805_BCL2L2-03        ----------------
A0A2I3RTV4_MCL1-01      ----------------
A0A2I3RTV4_MCL1-02      ----------------
                                        

© 1998-2022Legal notice