Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      -------------MFGLKRNAVIGLNLY----------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
H2Q805_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A2I3RTV4_MCL1-01      -------------MFGLKRNAVIGLNLY----------------------
A0A2I3RTV4_MCL1-02      -------------MFGLKRNAVIGLNLY----------------------
H2Q805_BCL2L2-02        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
H2Q805_BCL2L2-03        -MAAAAAAAAAAGAAGGRGSGPGRRRHL----------------------
H2Q805_BCL2L2-04        -MAAAAAAAAAAGAAGGRGSGPGRRRHL----------------------
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      ----------------------------------MTDCEFGYIYRLAQDY
A0A2I3RA26_BCL2A1-      ----------------------------------MTDCEFGYIYRLAQDY
A0A2I3RA26_BCL2A1-      ----------------------------------MTDCEFGYIYRLAQDY
H2Q9G4_BCL2L10-01       -----------------------------------------MVDQWRERT
A0A2I3RTV4_MCL1-03      --------------------------CGGAGLGAGSGGATPPGGRLLATG
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          SQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
H2Q805_BCL2L2-01        --------------------------VCGAG--PGEGPAADPLHQAMRAA
A0A2I3RTV4_MCL1-01      --------------------------CGGAGLGAGSGGATPPGGRLLATE
A0A2I3RTV4_MCL1-02      --------------------------CGGAGLGAGSGGATPPGGRLLATE
H2Q805_BCL2L2-02        --------------------------VCGAG--PGEGPAADPLHQAMRAA
H2Q805_BCL2L2-03        --------------------------VPGAGGEAGEGAPGGAGDYGNGLE
H2Q805_BCL2L2-04        --------------------------VPGAGGEAGEGAPGGAGDYGNGLE
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      LQYVLQIP------------------------------------------
A0A2I3RA26_BCL2A1-      LQYVLQIP------------------------------------------
A0A2I3RA26_BCL2A1-      LQYVLQIP------------------------------------------
H2Q9G4_BCL2L10-01       TMADPLRE------------------------------------------
A0A2I3RTV4_MCL1-03      AKDTKPMG------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          GDDFSRRY----------------RRDFAEMSSQLHLTPFTARGRFATVV
H2Q805_BCL2L2-01        GDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQVS
A0A2I3RTV4_MCL1-01      KEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLTPD
A0A2I3RTV4_MCL1-02      KEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLTPD
H2Q805_BCL2L2-02        GDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQVS
H2Q805_BCL2L2-03        SEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEE
H2Q805_BCL2L2-04        SEELEPED------------------------------------QEEEEE
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          EELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRH
H2Q805_BCL2L2-01        DELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETR
A0A2I3RTV4_MCL1-01      SRRVARPPPIGA--------------------------------------
A0A2I3RTV4_MCL1-02      SRRVARPPPIGA--------------------------------------
H2Q805_BCL2L2-02        DELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETR
H2Q805_BCL2L2-03        PGLVEGDPGDGAI-------------------------------------
H2Q805_BCL2L2-04        PGLVEGDPGDGAI-------------------------------------
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          LHTWIQDNGGWDAFVE----------------------------------
H2Q805_BCL2L2-01        LADWIHSSGGWAEFTA----------------------------------
A0A2I3RTV4_MCL1-01      --------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEEL
A0A2I3RTV4_MCL1-02      --------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEEL
H2Q805_BCL2L2-02        LADWIHSSGGWELEAIKARVREM----------EEEAEKLKELQNEVEKQ
H2Q805_BCL2L2-03        --------EDPELEAIKARVREM----------EEEAEKLKELQNEVEKQ
H2Q805_BCL2L2-04        --------EDPELEAIKARVREM----------EEEAEKLKELQNEVEKQ
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
H2QEM8_BCL2-01          -----------------------------------LYGPSM----RPLFD
H2Q805_BCL2L2-01        -----------------------------------LYGDGALEEARRLRE
A0A2I3RTV4_MCL1-01      DGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYR
A0A2I3RTV4_MCL1-02      DGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYR
H2Q805_BCL2L2-02        MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHFHG
H2Q805_BCL2L2-03        MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHFHG
H2Q805_BCL2L2-04        MNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEELEAHFHG
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      ----------------------------QPGSGPSKTSRVLQNVAFSVQK
A0A2I3RA26_BCL2A1-      ----------------------------QPGSGPSKTSRVLQNVAFSVQK
A0A2I3RA26_BCL2A1-      ----------------------------QPGSGPSKTSRVLQNVAFSVQK
H2Q9G4_BCL2L10-01       ----------------------------RTERLLADYLGYCAREPGTPEP
A0A2I3RTV4_MCL1-03      ----------------------------RSGATSRKALETLRRVGDGVQR
A0A2I3RTV4_MCL1-04      --------------------------------------------------
G2HFR3_MCL1-01          -------------------------------MDICRLSAAMREFYIVHLD
H2QEM8_BCL2-01          FSWLSLKTLL----------------------------------------
H2Q805_BCL2L2-01        GNWASVRTVLT---------------------------------------
A0A2I3RTV4_MCL1-01      ----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQR
A0A2I3RTV4_MCL1-02      ----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQR
H2Q805_BCL2L2-02        CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD-----------
H2Q805_BCL2L2-03        CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD-----------
H2Q805_BCL2L2-04        CGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD-----------
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      EVEKNLKSCLDNVNVVSVDTARTLFNQV---------MEKEFEDGI----
A0A2I3RA26_BCL2A1-      EVEKNLKSCLDNVNVVSVDTARTLFNQV---------MEKEFEDGI----
A0A2I3RA26_BCL2A1-      EVEKNLKSCLDNVNVVSVDTARTLFNQV---------MEKEFEDGI----
H2Q9G4_BCL2L10-01       TPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDS
A0A2I3RTV4_MCL1-03      NHETAFQGMLRKLDIKNEDDVKSLSRV----------MIHVFSDGV----
A0A2I3RTV4_MCL1-04      ---SVETCMLRKLDIKNEDDVKSLSRV----------MIHVFSDGV----
G2HFR3_MCL1-01          IYPPPECTIHMLLDIKNEDDVKSLSRV----------MIHVFSDGV----
H2QEM8_BCL2-01          --SLALVGACITL-------------------------------------
H2Q805_BCL2L2-01        --GAVALGALVTV-------------------------------------
A0A2I3RTV4_MCL1-01      NHETAFQGMLRKLDIKNEDDVKSLSRV----------MIHVFSDGV----
A0A2I3RTV4_MCL1-02      NHETAFQGWVCGV---------------------------LPCRGP----
H2Q805_BCL2L2-02        --ESLFRGRQIKV------IPKRTNRP----------GISTTDRGF----
H2Q805_BCL2L2-03        --ESLFRGRQIKV------IPKRTNRP----------GISTTDRGF----
H2Q805_BCL2L2-04        --ESLFRGRQIKV------IPKRTNRP----------GISTTDRGF----
                                                                          

A0A2I3RA26_BCL2A1-      --------------------------------------------------
A0A2I3RA26_BCL2A1-      --INWGRIVTIFAF-------EGILIKKLLRQQIAPDVDTY--------K
A0A2I3RA26_BCL2A1-      --INWGRIVTIFAF-------EGILIKKLLRQQIAPDVDTY--------K
A0A2I3RA26_BCL2A1-      --INWGRIVTIFAF-------EGILIKKLLRQQIAPDVDTY--------K
H2Q9G4_BCL2L10-01       PGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGFQPRLNEQEGDVARDCQ
A0A2I3RTV4_MCL1-03      --TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------E
A0A2I3RTV4_MCL1-04      --TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------E
G2HFR3_MCL1-01          --TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------E
H2QEM8_BCL2-01          --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3RTV4_MCL1-01      --TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------E
A0A2I3RTV4_MCL1-02      --RRW----------------------------HQECA-----------A
H2Q805_BCL2L2-02        --PRARYRARTTNY-------NSSRSRFYSGFNSRPRG-----------R
H2Q805_BCL2L2-03        --PRARYRARTTNY-------NSSRSRFYSGFNSRPRG-----------R
H2Q805_BCL2L2-04        --PRARYRARTTNY-------NSSRSRFYSGFNSRPRG-----------R
                                                                          

A0A2I3RA26_BCL2A1-      ------------VARSWLTAA---STSTAQENGFVKKFEH-------KSG
A0A2I3RA26_BCL2A1-      EISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPMLVESVAH-------KKR
A0A2I3RA26_BCL2A1-      EISYFVAEFIMNNTGEWIRQNGGWEN------GFVKKFEH-------KSG
A0A2I3RA26_BCL2A1-      EISYFVAEFIMNNTGEWIRQNGGWEN------GFVKKFEH-------KSG
H2Q9G4_BCL2L10-01       RLVALLSSRLVGQHRAWLQAQGGWD-------GFCHFFRTPFPLAFWRKQ
A0A2I3RTV4_MCL1-03      PLAESITDVLVRTKRDWLVKQRGWD-------GFVEFFHVEDLEGGIRNV
A0A2I3RTV4_MCL1-04      PLAESITDVLVRTKRDWLVKQRGWD-------GFVEFFHVEDLEGGIRNV
G2HFR3_MCL1-01          PLAESITDVLVRTKRDWLVKQRGWD-------GFVEFFHVEDLEGGIRNV
H2QEM8_BCL2-01          --------------GAYLGHK-----------------------------
H2Q805_BCL2L2-01        --------------GAFFASK-----------------------------
A0A2I3RTV4_MCL1-01      PLAESITDVLVRTKRDWLVKQRGWD-------GFVEFFHVEDLEGGIRNV
A0A2I3RTV4_MCL1-02      GFCRCCWS------RSWF--------------------------------
H2Q805_BCL2L2-02        VYRGRARA------TSWYSPY-----------------------------
H2Q805_BCL2L2-03        VYRGRARA------TSWYSPY-----------------------------
H2Q805_BCL2L2-04        VYRGRARA------TSWYSPY-----------------------------
                                        :                                 

A0A2I3RA26_BCL2A1-      WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
A0A2I3RA26_BCL2A1-      KMAL---------------------------------------
A0A2I3RA26_BCL2A1-      WMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYFYF
A0A2I3RA26_BCL2A1-      WMTFLEVTGKICEMLSLLKQ-YC--------------------
H2Q9G4_BCL2L10-01       LVQAFLSCLLTTAFIYLWTRLL---------------------
A0A2I3RTV4_MCL1-03      LLAFAGVAGVGAGLAYLIR------------------------
A0A2I3RTV4_MCL1-04      LLAFAGVAGVGAGLAYLIR------------------------
G2HFR3_MCL1-01          LLAFAGVAGVGAGLAYLIR------------------------
H2QEM8_BCL2-01          -------------------------------------------
H2Q805_BCL2L2-01        -------------------------------------------
A0A2I3RTV4_MCL1-01      LLAFAGVAGVGAGLAYLIR------------------------
A0A2I3RTV4_MCL1-02      --------GISNKIALL--------------------------
H2Q805_BCL2L2-02        -------------------------------------------
H2Q805_BCL2L2-03        -------------------------------------------
H2Q805_BCL2L2-04        -------------------------------------------
                                                                   

© 1998-2022Legal notice