Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mamfmlarnavaglalycggrlrqkgyvcgsgpgrggatvplhqggrllatekeasarryeigggeagavipggagdygn
  tpgakaataiaangaa ya        mlha srrhlpr   emvmkyihyktrq g twadldvqegagpssaqqrf
    as pd r lv dfv  k         a   etpydn    ai aagd f l f    fsa a  lhvt a      
                                      ad                      d      ap         
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gspsseltpeslrrvarpppigaevpdvtrtparllffaptrraaplqemeeepglvqewmvaylegdpadgaisspeee
alepet eqdg llepe e epe e pwpalvpgfvgpgalsgesvse e alv q          trlgadihmdqgw 
tqv d  f ge               nrg a  fap g  gca pgnk   p                  pw fe g   
          d                                                                     
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------td---g--gpla---e--------------pr-gatasklsrvmrrvgsv
legikprvremreeveklkelqnevgkqmn--psp-yt-rv-qdy-qyvlrqarsiyvgn--y-sgpeeteahlqncaft
 dayeaeplgkepaalptlpyvgpsenntmmsgplpniy--imsilekmeqislevisryvqpq--ga-----fhg--as
 p ht mfgls np ir sl ctgaapgassgcefssapqpveeevdelyadkgy cgahlderra--ddtkp---sy--
      h aa  d  ag n       l  aapaat pvrawratttmdtppr       ggtteqlsdrylqaygefpde
                             g    a mgd  l rgakakklm        egs pdlrpfhgycaaefig
                                    d       f g d             l m ic a et   d g 
                                                                        r   a   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vrkt------------------------------vetnfrgrlrkv-----divkslsrv----------mihvfsdgv-
nqvellcdkfsghpkgfayiefsdkesvrtslalh-sllqsmqinldvkne-dprrtfnpvlgypgnrfegestter-il
----ietlrrvargrfatvv elfrdg qrnrivdskaek-c-d--nivsvsta-t-n-qy         --kl-d-wf 
seta hltp t                 nwg   -r-p--tvvcvehatprq--q-f-s-          lv-epals- 
pssr                              ypr- td-m-saa rlg sqn etqa          sde-m-g p 
mlrq                              pfpv scwhmq       ah   m              dniq  m 
h pn                              f ft galaal                           a  c    
f di                              a  e c i  g                                   
                                       a                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     *          
-----tnwgrivtlisf-------gafvakhlktinqepcv-----------eplaesitd------rsWlvkqggwd--
sdspgpraryrar-f--agtller---l--------srsridtyegdvardcrvysyrvravlvrtktd isqn----nw
     i-------t-ny       nss-srkysrqqia-dgneq        keirgfaaefimnntge yrpyrtsekq
     -tylnvhlita        egiritfwlgfg--e--           ---------y etvlht fqa-s  ta 
     re   l afvv         pl tarsvnwemq ll           qrvvrwmwsr  grhaa  --s   g  
               t          a c e  kk h   a           gqfqallv     qa    tsa   a  
                                    f               ag c ccs           hd       
                                                                                
                                                                                

       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                  
-----gfveff---------r--l-af--v-gv--glayl--------------------------
hnhtp------hvedleggi-sv-m--ag-a--ga-----irtpycetglifltvmetiantyfyf
e    mltkkyehsmrplfwkngwltwlestlkitialtrldrylvhkffask             
     e chlvgtpfplearfkrkvqltllstllskmvstktqvtgga                  
     a  as rpga  a d lwesnkfs r itveiil wkll                      
           ad         q gla   c asnafci gga                       
                                  c   a  a                        
                                                                  
                                                                  
© 1998-2022Legal notice