Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mmatpmsardaralvalyvggklrqkgyvwdagdvgampplkrpaviilssypghtplpamtdcefgyiyrlaqdylqyv
 ahmfglkpntviglngfchyr s r  e        afggaan pggfnlqc gaghg gsrgpvprvsqwrtttapgc
   agaagaanaeaamdaa  a                                      a gdataptgp qergtmdt
     rt y    i  k i                                                mgd  lapa kad
                                                                               a
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g-gpg-gsapsp---glr--a---e---rr-fagglaglnvtggdtvrslfnv----------meelfpdg---------
-q---s-rglpktsrv--nv-dev-krv--n-ksmerqvhivsvagaktfssqvlgypgnrfesikvtegslrrvarpvp
lliaqprp----lhqamqragfsfqteyektlsdcadnadakpesd--r-arpy         pvheesek llepe il
pargrrs-htvvyll-gallytvksrsfstpeg-lvskevlpnstaqy-ntqe          vstkmqhe       p 
ksmeaeegvadrv gtc afpitplatapsei-t-smssg glrqidqgqglg          lda  r d       e 
ap   t mtsrda ey  qe ggh pnp pv tevh r w raf  sta eta          f    a           
     l alic   a   e   d  dih  d qci  l a   a  rg                                
        d a                   a ca            h                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----pnwgrivtlfsf-------gaplikklktqemep-v-----------g-v-------lvr-pgdwiiqs------
igaevt-----paiia-agtlleregivc-hsvriqqasl-dtyegdvardc-plaewvtey-e-ttreglvkqpgwele
spspgidvtat--f--g       --f-are-lnkni-edineq        keisysmadvi-nnlaadarsngeed d
ede e-trp l p-lv        fp-t-aaa--e-esacp           eq-qlfivaf mgrk----qmd   a  
     vp   v  rvl        p amrv-wpl-g-q-el           ql vallssr ntd-ht  he-      
          a  gat          vgttrpgsw f  r            dr           qh    --       
               p          l sg   kr                  n           h      d       
               e                                                        a       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aikarvrgmeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleapfhgcgsvsr
gyepeplekrpavlpfl  vgpsgnntstdgslpstpspaeee delyrqslevisrylreq lgakdtkhmgrssatnl
ftalygd al   rr v  y               wa               t lt a al   vt  mr lfdf wl  
              a r                                                               
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vtllclkfvghpkgfayiefsdkesvrtslaldeslfrgrqikvdiknedipkrtnrpgisttdrgfpraryrarttnyn
kaietdrrs acitl        dg qrn   h ta q wvrgl      dv sls vm hvpsd vtnwgrivtlisfg
    s al                               mlc                   lfc  pr            
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 :                                              
-------------------------------ggwd----------------------------f----g-------l---
ssrsrfysgfnsrprgrvyrgraravlvrtkrsyyspyrhwpgfveffhvedleggirnvlla-agva-vgaglay-irt
afvakhlkti qqscieplcrsiwv      taflnwkngtdmlckkvehpfplafwksgwmtllestlkisimltrkdr
           hee aagfaeccts      sd fvsq       hs rt        krkvqafl c lttkiis wtq
                        d         ekkh          a          q         isnef l lk 
                                  mgh                                  ca       
                                  ga                                            
                                                                                

       490       500   
....:....|....:....|...
                       
-----------------------
pycetglifltvmetiantyfyf
ll                     
                       
                       
                       
                       
                       
© 1998-2022Legal notice