Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       .                                        
----------------------l--y--------gstgatppdtralvt----yklr-----------g-----------
mvdqwrerttmmfglrrnavig-nl-cggaglgamagp-sayggtlialdfvg----qrgygqkgyvc-agpggsppstl
     mdicrlsdpmkeryivl di l ycarep----rpgstpeihmakykhtarsei gewdagdv gsapaaa apg
           aaa   fterh ad        matpep   en ea mgkids pm     ea a i  a         
                                   ha      c     eaea                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------pa----------------------------------
tpssrrvhtpppigsrvpvvtttplrtpffpptrraapleemeg--adplmspeeeldgyepeplgkrpavlpllelvge
ifd qpgar h aaaed daras aqllaaagaa        aa  lsav                              
                                                 i                              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------h-tlrragdgfqrrhrrtfs
sgnntstdgslpstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrka-q---av--evetnfeta-q
                                                        ppvvleam --aa--------- -
                                                             l   s   rlsqiy sf a
                                                                 q   d r     d  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       :: ..        .***:*::. *       *  :     .   .. :         
gmlrqlhitpeddvkslsrvmihlfsdgv------tnWGRiVtlisF-------Gafvckhsktinqeplv---------
dlaakpdvkngsaqqrftq-sdevmqgs-lsdspgpt   l affv agtller palaaelvnkemsscineqegdvar
----- gnrff-------- vva  r         v    v   vt         gvmtvrw kwgfrl         
eyssy  l   t rg  at le   a                   e          l  t    r               
a  g                                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :   :   *      *:  . **                                                     
--eplaewmtdyLvrtlrdWlvkqgGWd-gfveffhvedle----------------------ggirnv-----------
dcgqvqlsivav etrkat iqssr  eleatklyg-----earrlrelqnevekqmnmsppppnwgpqimsiefkmswl
  qrivallssr ngqhha  hdn   a a iharvtpmpl  ek k                asmasl     edfead
  dn      e    h      a        ca  rrgfe                        fa k            
                                    d a                                         

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :                                                                   
-llafagvagvgagla----------------------------------------------------------------
srvvlvssvlltttvteleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtn
a ttytlncdy  lii                                                                
  sqal l a   cfe                                                                
  ki f a     aa                                                                 

       490       500       510       520       530         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
----------------------------------------------------ylir---
rpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgrarvgaylswkrll
                                                ltswfgsy   
                                                a  f apt   
                                                      h    
© 1998-2020Legal notice