Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------------ga
mmaapasapdtrgmvglkrnyvlrqrlyewdagdvgaappgaapapgifssqpghtphpaasrdpvartsplqtpavp--
 ahtaragaaaaalfagrvsakiglngl                                                cg  
    g t y n eaamdfgggpgsrkh                                                 ac  
             i  kyih                                                            
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----g-g-a-gpg-rll--e-ee-e-re----------------------------------------------------
glga-e-p-t---y---rt-l--v-r--lllepepepepeeepprrtfselaaqlhvtpgaaqqrfttvsselvqggpnw
agepmtdgefpyihqgaqdygqyflqip                 igggdagsviggsafssppstlqpeprrferpvpi
 a  asscpgdavgyanalasdasapef                 prappmspgp pgs tprsqeeeeddg  add gd
     l ava vldlwmgatkmdlstmy                  d a g     l     gg  a  ve   r     
         p m   trergtk tpl g                                                    
                  q a  dk  d                                                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gaivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssegpeleaikarvremaptrraapleeeeaekl
 rl    e  gvm v    r  s   dnial  te  nrh ht  qdngvwdvtvtp  llff           m  paa
                                                 d aefte                        
                                                    a  a                        
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
kelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvlpdygptaeeleahlhgcgsvnrvtilcdkfsghpkg
daimspe eldgye e lgkr avlpll lvgesgnntstdgs  stpapml earefyrgswlsslevisrylreqat 
                                             l  ds     dr refn aqvr l t         
                                                 g      p fd     lk             
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------g---skal--------------etafrgrlrkv--------ksl-r-----------mi-vfsdgv----
fayiefsdrs-vtt----rvlrrvgfsvqrnv-snlqsmqinldiknediv---s-vvlgypgnrfe--h---r--lsds
akdtkpmgqpssrsrltsetmqnfadgplkehsklek-c-dt-nvvsvqdprttfnqy         gestte-si    
        keeagpcry dycaeeyivheptyp-v--tav--aaarlr ta rfnsp          lvkepd  f    
         t rlladl ga    pgt  dipgppavc-hvs        h     a            almc  p    
           mdi    a              l- tawcml                              a       
                                 a  l v cg                                      
                                    c i                                         
                                    a                                           

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                  :             
--tnwgrivtl--f-------g--v-k-lk--nqepci-----------eplaesitd------rswlvkq-gw------
pgpr-------is-agtller-af-a-h--ti---sr-dtyegdvardc---------vlvrtkgdyysqyr--dnwtnq
  --aryrarttny       nssrsrkysrqqsr--vneq        rvysyrvrefimnnttefirpng  etshah
  it   v  ifa        egilitfwlgfgiaedg           keirgfaaar  gvh a f-ak   sk    
  r        vt         pl t r  kw hq  l           qrfvrllws    qa    t--   g     
                                 f   a           ag caccs           qsa         
                                                                    gh          
                                                                    a           
                                                                                

       490       500       510       520       530       540   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                                               
--gfv--f---------------f----g-------l--------------------------
tp---ef-hvedleggirnvlma-agva-vgaglay-irtpycetglifltvmetiantyfyf
enmlckkvehpfplafwksgwltllestlkisimltrkdrll                     
     hs rt        krkvqafl c lttkiis wtq                       
        a          q         isnef l lk                        
                               ca                              
                                                               
                                                               
                                                               
© 1998-2022Legal notice