Dataset for protein BCL-2-like of organism Oryzias sinensis

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8C7X109_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oryzias sinensis GN=MCL-1 (length=284 residues).
MFPLQKQMVNSYITSNCGFTGHILGRAGEMSARVPLPSTLASRVANPDPSDPIKRPQDLEYSTRRFHDVDDDGSLPNTPE
LECEASVSGDNSGIDALNENTREFLTNFFRNFVGISQYPNRDNKYMSTAKRVVNDVLEKHKITYNGMIVRLSLDDQGDDM
SFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQDLKEKGRGHCVDLVSQEICTYLLSEQRNWLVNNNSWDGFVEFFRVSD
PETTVRNTLVAFLGIAGVGALLAQLNMMAFFKGLPASARLHNSR
>gnl|bcl2dbpro|A0A8C7XSQ2_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Oryzias sinensis GN=BCL2L1 (length=214 residues).
MTKWKKSWHLTYKMSCRDYPVSLLKPTDDGGETEEDHSTARNGRPVSSEDGQLRRSCPCCASMDAIKSTLKDSADEFERR
FHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISP
WIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A8C7XSQ2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias sinensis GN=BCL2L1 (length=217 residues).
MSHCNRELVRFYLAYKMSCRDYPVSLLKPTDDGGETEEDHSTARNGRPVSSEDGQLRRSCPCCASMDAIKSTLKDSADEF
ERRFHQGFSDLSVQLHITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQ
ISPWIHSHGGWDCFARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR
>gnl|bcl2dbpro|A0A8C7XY96_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oryzias sinensis GN=BCL2L10 (length=192 residues).
MSCGLRKETLAVALDYLSLSCRSPLQAPPPPSESAAAMRRLAQDMEAQYQPRFSTLAQNFRKHSGPDLCSSLRKVMEELV
GDERLNWGRVVSLFAFVGVLARQLREQTDMNPGLDPGREVAGGPVSCQALAETVADFLGGDKKEWMLENDGWEGFCKFSR
TAREVSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A8C7YJI1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oryzias sinensis GN=BCL2L1 (length=230 residues).
MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEHSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDA
VKEALRDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVECVEKEMSPLVDR
IVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL
>gnl|bcl2dbpro|A0A8C7ZK61_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oryzias sinensis GN=BCL-2 (length=228 residues).
MANVSNRSIVEKYICHKLSKRGYVCGLNGGQPENAANNGSVGDHSPTPVRRRCDAGTGPDEESSPRLIRALSRADPLADI
HRVLREAGDELERLYQRDFTEMSRQLYLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVAS
IAEWMTEYLNGPLNSWIEENGGWDAFVELYDRQKETVFSCYWPSIKTVFGLAALGAASLTIGAYLAQK
© 1998-2023Legal notice