Dataset for protein BCL-2-like of organism Oryzias sinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .      :   . .                                                            
----lnrelvvfylty-klscrgypvs--------l--p--d-----ggetee--------dhstarngr----g--p--
mmsvstkwtlswhikslsmgqtd--lgragemsar-lk-td-psrva---p--pinrpsvle--------vvds-tg-vt
 snsrr smkrvavdh nc k -hv--        vpvlstsan t npq-snaakngqdg-y pttvrnrtsnest ns
 ampmq qk ns  c     f n icn        hil nen     a dvgd            rphhdpdfd dl ge
  fhc   i ek  a                          l                       e fa gc a    d 
  cg      a                                                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .    ::   :                               :. :  .:      
----qlr-rslpccasmdaikstlrdsadeferry----------------------------qqgfsdlsvqlhitpdt
pels---esvcssttppsevneatketltnmflqfvgisqypnrdnkymstakrvvndvlekhhrtyntmisrfylhstp
sssprei qqsqrpsnladshrvm rlgqdl an                             kpr tn hrn skddqg
epdgp a  p gdnpgi  laan   f n    l                             ald  g aq  r   g 
   ec    a  aad           a                                     ia  e         a 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .  * ..*. *   ****::.:: * ..:. :   :   .  :               : : :  :*      *:
ay-qsfkrVmdeLfrDg-iNWGRvvglfaFggalcvecv-ernmgplvd-------------riaewmtqyLdgqispWi
dlmsnvss lns vk ntv    iisflv vavvarqlrsqkerseqlspgrevaggpvscqsvvqtvcvf nepqrs m
 kctrlrn i  g ert      a  e   t  qd kentg ntg a             lls eiat  lshlqn l
 d  f ek a  a   l                   a  ed  hc               a      e  gnekne  
      ae                                                             d    d k   
                                                                                

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
 .:..*: *  :                     :                 .:     :     
hsnggWdgFaelygqngaaearrfqetlkkwmlvt-----------valltglllgvlltqkr-
vehns ec vrff----stttve--qssvtvlglagvgallaqlnmmtvavsvtvsafiaks-l
qnq  r cki-rvskprvsscywpdismktaig           algsk  pilty lvr  
l      a     drqdee f  vsn f aff  f             ffa  ag sr hn   
e              ea      s                        a     a         
                                                                
© 1998-2023Legal notice