Dataset for protein BCL-2-like of organism Oryzias sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7X109_MCL1-01      -MFPLQKQMVNSYITS-NCGFTGHILGRAGEMSARVPLPSTLASRVANPD
A0A8C7XY96_BCL2L10      MSCGLRKETLAVALDYLSLSCR----------------------------
A0A8C7XSQ2_BCL2L1-      -MSHCNRELVRFYLAY-KMSCRDYPVS--------LLKPTDD-----GGE
A0A8C7YJI1_BCL2L1-      --MSRNRELVVFYVKY-KLSQRNYPLN--------HIVLNESPNRTAAGE
A0A8C7XSQ2_BCL2L1-      ----MTKWKKSWHLTY-KMSCRDYPVS--------LLKPTDD-----GGE
A0A8C7ZK61_BCL2-01      MANVSNRSIVEKYICH-KLSKRGYVCG--------L-----N-----GGQ
                              .      :   . .                              

A0A8C7X109_MCL1-01      PSDPIKRPQDLEYSTRRFHDVDDDGSLPNTPELECEA-SVSGDNSGIDAL
A0A8C7XY96_BCL2L10      --------------------------------------SPLQAPPPPSES
A0A8C7XSQ2_BCL2L1-      TEE--------DHSTARNGR-------PVSSEDGQLR-RSCPCCASMDAI
A0A8C7YJI1_BCL2L1-      VGE--------EHSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDAV
A0A8C7XSQ2_BCL2L1-      TEE--------DHSTARNGRPVSSEDG-------QLR-RSCPCCASMDAI
A0A8C7ZK61_BCL2-01      PENAANNGSVGDHSPTPVRRRCDAGTGPDEESSPRLI-RALSRADPLADI
                                                                          

A0A8C7X109_MCL1-01      NENTREFLTNFFRNFVGISQYPNRDNKYMSTAKRVVNDVLEKHKITYNGM
A0A8C7XY96_BCL2L10      AAAMRRLAQDMEAQY----------------------------QPRFSTL
A0A8C7XSQ2_BCL2L1-      KSTLKDSADEFERRF----------------------------HQGFSDL
A0A8C7YJI1_BCL2L1-      KEALRDTANEFELRY----------------------------ALAFNNL
A0A8C7XSQ2_BCL2L1-      KSTLKDSADEFERRF----------------------------HQGFSDL
A0A8C7ZK61_BCL2-01      HRVLREAGDELERLY----------------------------QRDFTEM
                            .    ::   :                               :. :

A0A8C7X109_MCL1-01      IVRLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQDLK-
A0A8C7XY96_BCL2L10      AQNFRKHSGPDLCSSLRKVMEELVGDERLNWGRVVSLFAFVGVLARQLRE
A0A8C7XSQ2_BCL2L1-      SVQLHITPDTAY-QNFKRVLDELFKDG-INWGRVVGLFVFGGALCVECV-
A0A8C7YJI1_BCL2L1-      HSQLHITPATAY-QSFENVMNELFRDN-INWGRIVGLFAFGGALCVECV-
A0A8C7XSQ2_BCL2L1-      SVQLHITPDTAY-QNFKRVLDELFKDG-INWGRVVGLFVFGGALCVECV-
A0A8C7ZK61_BCL2-01      SRQLYLTSTTAK-TRFAEVIDELFRDG-VNWGRIIAFFEFGGTVCVECAS
                          .:           .  * ..*. *   ****::.:: * ..:. :   

A0A8C7X109_MCL1-01      EKGRGHCVD-------------LVSQEICTYLLSEQRNWLVNNNSWDGFV
A0A8C7XY96_BCL2L10      QTDMNPGLDPGREVAGGPVSCQALAETVADFLGGDKKEWMLENDGWEGFC
A0A8C7XSQ2_BCL2L1-      ERNMGELVS-------------RIAEWMTQYLDEQISPWIHSHGGWDCFA
A0A8C7YJI1_BCL2L1-      EKEMSPLVD-------------RIVEWMTVYLDNHIQPWIQSQGGWERFA
A0A8C7XSQ2_BCL2L1-      ERNMGELVS-------------RIAEWMTQYLDEQISPWIHSHGGWDCFA
A0A8C7ZK61_BCL2-01      NEEMSTQVA-------------SIAEWMTEYLNGPLNSWIEENGGWDAFV
                        :   .  :               : : :  :*      *: .:..*: * 

A0A8C7X109_MCL1-01      EFFRVSDPETTVR--NTLVAFLGIAGVGALLAQLNMMAFFKGLPASARLH
A0A8C7XY96_BCL2L10      KF-----SRTAREVSQDSSMKTALF-----------AAASVGLAGLTFLL
A0A8C7XSQ2_BCL2L1-      RLYGQNGAAEARRFQETLKKWMLVT-----------VALLTGLLLGVLIT
A0A8C7YJI1_BCL2L1-      EIFGQEAAAESRRSQESFKKWLLVG-----------MTVATGVLVGSFLA
A0A8C7XSQ2_BCL2L1-      RLYGQNGAAEARRFQETLKKWMLVT-----------VALLTGLLLGVLIT
A0A8C7ZK61_BCL2-01      ELYDRQKETVFSCYWPSIKTVFGLA-----------ALGAASLTIGAYLA
                         :                     :                 .:     : 

A0A8C7X109_MCL1-01      NSR-
A0A8C7XY96_BCL2L10      VR--
A0A8C7XSQ2_BCL2L1-      KKR-
A0A8C7YJI1_BCL2L1-      QKRL
A0A8C7XSQ2_BCL2L1-      KKR-
A0A8C7ZK61_BCL2-01      QK--
                            

© 1998-2023Legal notice