Dataset for protein Mcl-1 of organism Oreochromis aureus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A668RLC9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis aureus GN=MCL-1 (length=278 residues).
MTNYLMSKRNQFTFIDYLLPQNGVPEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHLDSESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHMTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
>gnl|bcl2dbpro|A0A668SNL1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis aureus GN=MCL-1 (length=240 residues).
MFSLNCCLSEWCPNNDVGFIDNWETLCRKPGLVRRDGIHPTLDGAALISRNLEDGSLPSTPEFHLDSESDEELERETKLI
IHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSFVAKSLFGDHTTNWGRIVSFVAF
GAVVSQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIVRNTLMAFAGFACIGATLALLIR
© 1998-2020Legal notice