Dataset for protein Mcl-1 of organism Oreochromis aureus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .::   .: .*:* .*  .: ..   . *  .* .   . .  .  :. :   
-------------------------mgsmnygsskwsPqNdvGssknwstlivspGtvrRpnnlpvtstngyktrnl---
mtnylmskrnqftfidyllpqngvpefplhcclgesc n at fiddsengcrkn lpk dgihetldgaaliskairdr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ***************************:***************************************************
-EDGSLPSTPEFHLDSESDEELERETKLlIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
e                           i                                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *****   ******.** *****************************.*****:************:********* *
RhEDMSF---VAKSLFgDHtTNWGRIVSFVAFGAVVSQHLKEKGRDNCVvLVSQEvSAYLLSEQRDWIvKNNAWDGFVeF
 e     vga      a  m                             a     i            i         a 

       250       260       270        
....:....|....:....|....:....|....:...
.******* ************ **********      
vRVADPEStVRNTLMAFAGFAgIGATLALLIR------
f       i            c          fwdall
© 1998-2020Legal notice