Dataset for protein Mcl-1 of organism Oreochromis aureus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A668RLC9_MCL1-01      MTNYLMSKRNQFTFIDYLLPQNGVPEGPMHYGSGKSSPQNATGSSKDSSN
A0A668SNL1_MCL1-01      -------------------------MFSLNCCLSEWCPNNDVGFIDNWET
                                                   .::   .: .*:* .*  .: ..

A0A668RLC9_MCL1-01      GIVSNGTPKRPNNLEVTSTNGYKTKAIRDREEDGSLPSTPEFHLDSESDE
A0A668SNL1_MCL1-01      LCRKPGLVRRDGIHPTLDGAALISRNL----EDGSLPSTPEFHLDSESDE
                           . *  .* .   . .  .  :. :    *******************

A0A668RLC9_MCL1-01      ELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
A0A668SNL1_MCL1-01      ELERETKLIIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
                        ********:*****************************************

A0A668RLC9_MCL1-01      GMINKLSLDERHEDMSFVGAVAKSLFADHMTNWGRIVSFVAFGAVVSQHL
A0A668SNL1_MCL1-01      GMINKLSLDEREEDMSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHL
                        *********** *****   ******.** ********************

A0A668RLC9_MCL1-01      KEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADPESTV
A0A668SNL1_MCL1-01      KEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIV
                        *********.*****:************:********* *.******* *

A0A668RLC9_MCL1-01      RNTLMAFAGFAGIGATLALLIRFWDALL
A0A668SNL1_MCL1-01      RNTLMAFAGFACIGATLALLIR------
                        *********** **********      

© 1998-2020Legal notice