Dataset for protein BCL-2-like of organism Oreochromis aureus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A668RI12_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Oreochromis aureus GN=BCL2L1 (length=232 residues).
MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPLNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTDL
DAVKEALRDTANEFELRYARAFSDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
GRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
>gnl|bcl2dbpro|A0A668RLC9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis aureus GN=MCL-1 (length=278 residues).
MTNYLMSKRNQFTFIDYLLPQNGVPEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKRPNNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHLDSESDEELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RHEDMSFVGAVAKSLFADHMTNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESTVRNTLMAFAGFAGIGATLALLIRFWDALL
>gnl|bcl2dbpro|A0A668SNL1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Oreochromis aureus GN=MCL-1 (length=240 residues).
MFSLNCCLSEWCPNNDVGFIDNWETLCRKPGLVRRDGIHPTLDGAALISRNLEDGSLPSTPEFHLDSESDEELERETKLI
IHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSFVAKSLFGDHTTNWGRIVSFVAF
GAVVSQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIVRNTLMAFAGFACIGATLALLIR
>gnl|bcl2dbpro|A0A668SSC1_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Oreochromis aureus GN=BCL2L10 (length=231 residues).
MSRGGVTHSLSAEGKTQLYRRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYLSFCCTSPHQAPPPPSESAAAMRR
LGWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQELG
QEPMSCRRLAETIADYLGEEKKDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A668TEB6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus GN=BCL-2 (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSIKTVFG
LAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A668TEB6_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus GN=BCL-2 (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPDQVAKIIVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAANKRE
>gnl|bcl2dbpro|A0A668TEB6_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus GN=BCL-2 (length=228 residues).
MANEYNRNIVEKYICHKLSKRGYVWGFRVVQEEDAANNGSITDPPPTLVHRCREASTGPDGESNTHLCRRLPQSDPHAGI
HRVLREAGDELERLYQPDFTEMSRQLHLTSATAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEGMSSQVDN
IADWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A668TEB6_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus GN=BCL-2 (length=186 residues).
MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
KQGAFITLVARDEVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEVEVDRFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAANKRE
>gnl|bcl2dbpro|A0A668TEB6_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Oreochromis aureus GN=BCL-2 (length=359 residues).
MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAIECY
KQGAFITLVARDEEKLLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDMLVNCAGTSVSGKFEEV
EVDRFKKLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQ
IVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAANKRE
© 1998-2020Legal notice