Dataset for protein BCL-2-like of organism Oreochromis aureus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A668TEB6_BCL2-04      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A668SSC1_BCL2L10      -------------------------------MSRGGVTHSLSAEGKTQLY
A0A668RI12_BCL2L1-      -----------------------------MSQNRELVLFYIRYKLSQRNY
A0A668TEB6_BCL2-05      ---------------------------MANEYNRNIVEKYICHKLSKRGY
A0A668RLC9_MCL1-01      ---------------------------MTNYLMSKRNQFTFIDYLLPQNG
A0A668SNL1_MCL1-01      --------------------------------------------------
A0A668TEB6_BCL2-02      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A668TEB6_BCL2-01      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A668TEB6_BCL2-03      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
                                                                          

A0A668TEB6_BCL2-04      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDE--
A0A668SSC1_BCL2L10      RRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYL----SFCCTSPH
A0A668RI12_BCL2L1-      PLNHIVL-----NEPLNRTDGGAAGLDEEQRIDTHANG----TFNGTSPG
A0A668TEB6_BCL2-05      VWGFRVV-----QEE-----------------DAANNG----SITDPPPT
A0A668RLC9_MCL1-01      VPEGPMH-----YGSGKSSPQNATGSSKDSSNGIVSNG----TPKRPNNL
A0A668SNL1_MCL1-01      --MFSLN-----CCLSEWCPNNDVGFIDNWETLCRKPG----LVRRDGIH
A0A668TEB6_BCL2-02      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
A0A668TEB6_BCL2-01      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
A0A668TEB6_BCL2-03      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
                                                                          

A0A668TEB6_BCL2-04      -----------------VVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668SSC1_BCL2L10      QAPPPPSESAAA------------------------MRRLGWDIERQ---
A0A668RI12_BCL2L1-      TPPASPQRQQQP------------PSTTDLDAVKEALRDTANEFELR---
A0A668TEB6_BCL2-05      LVHRCREASTGPDGESNTHLCRRLPQSDPHAGIHRVLREAGDELERL---
A0A668RLC9_MCL1-01      EVTSTNGYKTKAIRDREEDGSLPSTPEFHLDSESDEELERETKLLIHSFL
A0A668SNL1_MCL1-01      PTLDGAALISRNL----EDGSLPSTPEFHLDSESDEELERETKLIIHSFL
A0A668TEB6_BCL2-02      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668TEB6_BCL2-01      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668TEB6_BCL2-03      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
                                                                  .:      

A0A668TEB6_BCL2-04      VNCAGTSVSGKFEEVEVDRFKIVT--------------------------
A0A668SSC1_BCL2L10      ------------------------------HQARFDNLAQTFLVQCGPDH
A0A668RI12_BCL2L1-      ------------------------------YARAFSDLHSQLHITPATAY
A0A668TEB6_BCL2-05      ------------------------------YQPDFTEMSRQLHLTSATAQ
A0A668RLC9_MCL1-01      GDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDERHED
A0A668SNL1_MCL1-01      GDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDEREED
A0A668TEB6_BCL2-02      VNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK-ERRMGR
A0A668TEB6_BCL2-01      VNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK-ERRMGR
A0A668TEB6_BCL2-03      VNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAVITTMK-ERRMGR
                                                                          

A0A668TEB6_BCL2-04      ----------------------MGLFR-----------------------
A0A668SSC1_BCL2L10      CLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQE
A0A668RI12_BCL2L1-      -QSFENVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKE--MSP-----
A0A668TEB6_BCL2-05      -RRFAEVIDELFRDG-VNWGRIIAFFEFGGTVCVECASNE-GMSS-----
A0A668RLC9_MCL1-01      MSFVGAVAKSLFADHMTNWGRIVSFVAFGAVVSQHLKEK--GRDN-----
A0A668SNL1_MCL1-01      MSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEK--GRDN-----
A0A668TEB6_BCL2-02      IMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE-----
A0A668TEB6_BCL2-01      IMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE-----
A0A668TEB6_BCL2-03      IMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE-----
                                              :.:.                        

A0A668TEB6_BCL2-04      --------------------------------------------------
A0A668SSC1_BCL2L10      LGQEPMSCRRLAETIADYLG------------------------------
A0A668RI12_BCL2L1-      ------LVGRIVEWMTVYLD------------------------------
A0A668TEB6_BCL2-05      ------QVDNIADWMTEYLN------------------------------
A0A668RLC9_MCL1-01      ------CVALVSQEVSAYLL------------------------------
A0A668SNL1_MCL1-01      ------CVVLVSQEISAYLL------------------------------
A0A668TEB6_BCL2-02      ------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A668TEB6_BCL2-01      ------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A668TEB6_BCL2-03      ------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
                                                                          

A0A668TEB6_BCL2-04      --------------------------------------------------
A0A668SSC1_BCL2L10      ----EEKKDWLLDNDGWEG-------------------------------
A0A668RI12_BCL2L1-      ----NHIQPWIQSQGGWER-------------------------------
A0A668TEB6_BCL2-05      ----GPLNSWIQDNGGWDA-------------------------------
A0A668RLC9_MCL1-01      ----SEQRDWIVKNNAWDG-------------------------------
A0A668SNL1_MCL1-01      ----SEQRDWIIKNNAWDG-------------------------------
A0A668TEB6_BCL2-02      GVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQ
A0A668TEB6_BCL2-01      GVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQ
A0A668TEB6_BCL2-03      GVCQPDQVAKIIVRDAI---------------------------VTMGLF
                                                                          

A0A668TEB6_BCL2-04      -------------------------TIALFYLGSFDSIVRRCMIQREQSK
A0A668SSC1_BCL2L10      ---FCKFSRSAREVSQDSSMK--KALFAAAGVGLAGLT---FLLVR----
A0A668RI12_BCL2L1-      ---FAEIFGQDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL--
A0A668TEB6_BCL2-05      ---FVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK----
A0A668RLC9_MCL1-01      -------------------------FVEFFRVADPESTVRNTLMAFAGFA
A0A668SNL1_MCL1-01      -------------------------FVAFVRVADPESIVRNTLMAFAGFA
A0A668TEB6_BCL2-02      QIVTMGLFR----------------TIALFYLGSFDSIVRRCMIQREQSK
A0A668TEB6_BCL2-01      QDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK----
A0A668TEB6_BCL2-03      R------------------------TIALFYLGSFDSIVRRCMIQREQSK
                                                  .               :       

A0A668TEB6_BCL2-04      AANKRE-----------
A0A668SSC1_BCL2L10      -----------------
A0A668RI12_BCL2L1-      -----------------
A0A668TEB6_BCL2-05      -----------------
A0A668RLC9_MCL1-01      GIGATLALLIRFWDALL
A0A668SNL1_MCL1-01      CIGATLALLIR------
A0A668TEB6_BCL2-02      AANKRE-----------
A0A668TEB6_BCL2-01      -----------------
A0A668TEB6_BCL2-03      AANKRE-----------
                                         

© 1998-2020Legal notice