Dataset for protein BCL-2-like of organism Oreochromis aureus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A668TEB6_BCL2-04      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A668TEB6_BCL2-02      MSSEEGFSSAITDWLFINTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A668SSC1_BCL2L10      -------------------------------MSRGGVTHSLSAEGKTQLY
A0A668RI12_BCL2L1-      -----------------------------MSQNRELVLFYIRYKLSQRNY
A0A668TEB6_BCL2-05      ---------------------------MANEYNRNIVEKYICHKLSKRGY
A0A668TEB6_BCL2-03      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A668TEB6_BCL2-01      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A668RLC9_MCL1-01      ---------------------------MTNYLMSKRNQFTFIDYLLPQNG
A0A668SNL1_MCL1-01      --------------------------------------------------
                                                                          

A0A668TEB6_BCL2-04      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDE--
A0A668TEB6_BCL2-02      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
A0A668SSC1_BCL2L10      RRSPSAVCMCREQSDIAGRKMKFCGLWKETLLLAEDYL------------
A0A668RI12_BCL2L1-      PLNHIVL-----NEPLNRTDGGAAGLDEEQRIDTHANG------------
A0A668TEB6_BCL2-05      VWGFRVV-----QEE-----------------DAANNG------------
A0A668TEB6_BCL2-03      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
A0A668TEB6_BCL2-01      SPKPLKL-----NGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARDEEK
A0A668RLC9_MCL1-01      VPEGPMH-----YGSGKSSPQNATGSSKDSSNGIVSNG----TPKRPNNL
A0A668SNL1_MCL1-01      --MFSLN-----CCLSEWCPNNDVGFIDNWETLCRKPG----LVRRDGIH
                                                                          

A0A668TEB6_BCL2-04      -----------------VVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668TEB6_BCL2-02      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668SSC1_BCL2L10      --------------------------SFCCTSPHQAPPPPSESAAA----
A0A668RI12_BCL2L1-      --------------------------TFNGTSPGTPPASPQRQQQP----
A0A668TEB6_BCL2-05      --------------------------SITDPPPTLVHRCREASTGPDGES
A0A668TEB6_BCL2-03      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668TEB6_BCL2-01      LLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVENVIKQAQEKLGPVDML
A0A668RLC9_MCL1-01      EVTSTNGYKTKAIRDREEDGSLPSTPEFHLDSESDEELERETKLLIHSFL
A0A668SNL1_MCL1-01      PTLDGAALISRNL----EDGSLPSTPEFHLDSESDEELERETKLIIHSFL
                                                                . .       

A0A668TEB6_BCL2-04      VNCAGTSVSGKFEEVEVDR-FKIVT-------------------------
A0A668TEB6_BCL2-02      VNCAGTSVSGKFEEVEVDR-FKKLMEVNYLGSVYPTRAVITTMK-ERRMG
A0A668SSC1_BCL2L10      --------------------MRRLGWDIERQHQARFDNLAQTFLVQCGPD
A0A668RI12_BCL2L1-      --------PSTTDLDAVKEALRDTANEFELRYARAFSDLHSQLHITPATA
A0A668TEB6_BCL2-05      NTHLCRRLPQSDPHAGIHRVLREAGDELERLYQPDFTEMSRQLHLTSATA
A0A668TEB6_BCL2-03      VNCAGTSVSGKFEEVEVDR-FKKLMEVNYLGSVYPTRAVITTMK-ERRMG
A0A668TEB6_BCL2-01      VNCAGTSVSGKFEEVEVDR-FKKLMEVNYLGSVYPTRAVITTMK-ERRMG
A0A668RLC9_MCL1-01      GDFTGLSQPQRKETKALKT-MKRVVADVLEKHRYAYNGMINKLSLDERHE
A0A668SNL1_MCL1-01      GDFTGLSQPQRKETKALKT-MKRVVADVLEKHRYAYNGMINKLSLDEREE
                                            :.                            

A0A668TEB6_BCL2-04      -----------------------MGLFR----------------------
A0A668TEB6_BCL2-02      RIMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE----
A0A668SSC1_BCL2L10      HCLSLRKVMKELVGDGHLNWGRVVSLFAFTGVLARKILEQKPGLDPGQQQ
A0A668RI12_BCL2L1-      Y-QSFENVMDEVFRDG-VNWGRIVGLFAFGGALCVECVEKE--MSP----
A0A668TEB6_BCL2-05      Q-RRFAEVIDELFRDG-VNWGRIIAFFEFGGTVCVECASNE-GMSS----
A0A668TEB6_BCL2-03      RIMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE----
A0A668TEB6_BCL2-01      RIMFVSSQAGQ------------IGLFGYTAYSPSKFALR--GLAE----
A0A668RLC9_MCL1-01      DMSFVGAVAKSLFADHMTNWGRIVSFVAFGAVVSQHLKEK--GRDN----
A0A668SNL1_MCL1-01      DMSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHLKEK--GRDN----
                                               :.:.                       

A0A668TEB6_BCL2-04      --------------------------------------------------
A0A668TEB6_BCL2-02      -------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKL---I
A0A668SSC1_BCL2L10      ELGQEPMSCRRLAETIADY-------------LGEEKKDWLLDNDGWEGF
A0A668RI12_BCL2L1-      -------LVGRIVEWMTVY-------------LDNHIQPWIQSQGGWERF
A0A668TEB6_BCL2-05      -------QVDNIADWMTEY-------------LNGPLNSWIQDNGGWDAF
A0A668TEB6_BCL2-03      -------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKL---I
A0A668TEB6_BCL2-01      -------SLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKL---I
A0A668RLC9_MCL1-01      -------CVALVSQEVSAY-------------LLSEQRDWIVKNNAWDGF
A0A668SNL1_MCL1-01      -------CVVLVSQEISAY-------------LLSEQRDWIIKNNAWDGF
                                                                          

A0A668TEB6_BCL2-04      --------------------------------------------------
A0A668TEB6_BCL2-02      SETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSIT
A0A668SSC1_BCL2L10      CKFSR---------------------------------------------
A0A668RI12_BCL2L1-      AEIFG---------------------------------------------
A0A668TEB6_BCL2-05      VELYD---------------------------------------------
A0A668TEB6_BCL2-03      SETSGVCQPDQVAKIIVRDAI---------------------------VT
A0A668TEB6_BCL2-01      SETSGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSIT
A0A668RLC9_MCL1-01      VEFFRVADPESTVRNTLMAFA-----------------------------
A0A668SNL1_MCL1-01      VAFVRVADPESIVRNTLMAFA-----------------------------
                                                                          

A0A668TEB6_BCL2-04      -----------------------------TIALFYLGSFDSIVRRCMIQR
A0A668TEB6_BCL2-02      EGLQQIVTMGLFR----------------TIALFYLGSFDSIVRRCMIQR
A0A668SSC1_BCL2L10      -------------SAREVSQDSSMK--KALFAAAGVGLAGLT---FLLVR
A0A668RI12_BCL2L1-      -------------QDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQK
A0A668TEB6_BCL2-05      -------------RQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A668TEB6_BCL2-03      MGLFR------------------------TIALFYLGSFDSIVRRCMIQR
A0A668TEB6_BCL2-01      EGLQQDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
A0A668RLC9_MCL1-01      -------------------------------GFAGIGATLALLIRFWDAL
A0A668SNL1_MCL1-01      -------------------------------GFACIGATLALLIR-----
                                                                          

A0A668TEB6_BCL2-04      EQSKAANKRE
A0A668TEB6_BCL2-02      EQSKAANKRE
A0A668SSC1_BCL2L10      ----------
A0A668RI12_BCL2L1-      RL--------
A0A668TEB6_BCL2-05      ----------
A0A668TEB6_BCL2-03      EQSKAANKRE
A0A668TEB6_BCL2-01      ----------
A0A668RLC9_MCL1-01      L---------
A0A668SNL1_MCL1-01      ----------
                                  

© 1998-2021Legal notice