Dataset for protein BCL-2-like of organism Oreochromis aureus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------mllvvaafivafvlllymisplispkplkl-----ngahvvvtggssgigkci
msseegfssaitdwlfintwwlllpfi-----nr-----yi--kls-rnyv-sfsvvcmcreqes----p-na--l--e-
                            tnyy--nrntk--sy---tq---wnhrmn     yspsnwt-q--v -we-w
                            amsqsskl qhtfrheglq-ggrrmgplh     ccllkssknkft ssdnt
                              emm gg l s id  kp   plg ia        eierrdm dc fi ds
                               l  e  e   ca   k     e           dgagc    a  d  q
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              .:                
aiecykqg----lvardepkllqakkevekfai----vvlcisvdvssdysqvenvikqaqeklgpvdmlvncagtsvsg
--lavsnlafittftgtseh-vp--p--st-p-ndkq-------tpefhldsesdelrergteierh-------------
stdtrny     sprdpp--t--st-sy--r-lresnedgslpsp-----------elrtewdflirsf gdft l qpq
rngihdp      inc nntqttrsrqrqsqndg reth  rrl-sttphagikram dlan  ilq             
ll  ea        k  gilpplppnglkqk              q d   a he      d    l             
e   a         c    geahdgaaeiag                                                 
                        c  a  a                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              :.:.              
kfeevevdrfk---------svyptravittlk-errmgr-mfvssvakq---d---nwgr-vglfaftayvpskfaer-
-----------kvmevnylghr-afngm-nqmslteatediss---qmgelfr-gtv----iisfvgyggvssvhlklke
rk tkalktm rlvadvlekyqr-y--ls-k-hvd---a-m--frn--dsvvg hmt    vma  r----lcqec---k
           i t      --pr-tn-hs-f-i-sgp-ycrrlgk i--  a  hl         e   t-----vsq 
                     aad se ar  l qp hdq q  ee                        a ar il n 
                         dd  q     c e h l  aa                                  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-glde-----------svqmeikpyniylt----------------------------------peqvdwiivndawdg-
p-rapgqqqelgqepmcl-rvsqwmta-vlvayppdtdtpglaeenktkpletklisetsgvcqsd-rak-qkrngv--n
  msn           --vliaeeis- --                                  --l---l-d-g--qr 
  ---           qcr-------v  n                                  npkqs  v-q- iea 
    s           l gnlvdtvae  g                                  ghinp  ls       
                  d       d  d                                  e  k            
                  a                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        .               :       
-------------------------------------------------------tialfylgsfdstvrrcliqr----
fnssvgpdgymlsaltcgmspvtsiteglqqivfvelyrrqrdsvfscswpsiktvfgfarvadasliigaymtakeqsk
                        v m  frdatmkifdsdaevssrs qk f kfvlvvatvapgvv--ntimvfagfa
                                  cgfsgqa aaeqdr me   awleagm  vte  a -l l  rl  
                                  a                    l    g  l       f a      
                                                                                
                                                                                

       410       
....:....|....:..
                 
-----------------
aankreallirfwdall
gigatl           
c                
                 
                 
                 
© 1998-2020Legal notice