Dataset for protein BCL-2-like of organism Oreochromis aureus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------mllvvaafivafvlllymisplispkplkl-----ngahvvvtggssgigkci
msseegfssaitdwlfintwwlllpfi-----nr-----yi--kls-rnyv-sfsvvcmcreqes----p-na--l--e-
                            tnyy--nrntk--sy---tq---wnhrmn     yspsnwt-q--v -we-w
                            amsqsskl qhtfrheglq-ggrrmgplh     ccllkssknkft ssdnt
                              emm gg l s id  kp   plg ia        eierrdm dc fi ds
                               l  e  e   ca   k     e           dgagc    a  d  q
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            . .                 
aiecykqg----lvarde-------------------vvlcisvdvssdyssvenvikqaqeklgpvdmlvncagtsvsg
--lavsnlafit------ekllqakkevekfaindkq---------efhltqpsdepleretstqi------------pq
stdtrny     tpr pnnlpvtstngyktrnlr reedgslpstptitgdpettperspsrqqlahsfsgdftclrq--
rngihdp       k  gihetldgaalisk                 ndp  hqahpp  a ai dge nthl r l s
ll  ea                                          cc   gl  ac     a               
e   a                                                                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :.                                                   :.:.             
kfeevevdr-fkrlmevnylgsvyptravittlk-errmgr-mfvssvakq---d---nwgr-vglfaftayvpskfaer
rk-tkalktvmrkvvadverkhr-afngm-nqmslteatediss---qmgelfr-gtv----iisfvgyggvssvhlklk
--p------al itg-e-le-yqr-y--ls-k-hvd---a-m--frn--dsvvg hmt    vma  r----lcqec---
ttdldgihe   eatw-l--r--pr-tn-hs-f-i-sgp-ycrrlgk i--  a  hl         e   t-----vsq
sd ha       d an i  q aad se ar  l qp hdq q  ee                        a ar il n
               d f  l     dd  q     c e h l  aa                                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--glde-----------svqmeikpyniy-------------laeenktwilenklw--fvetsgv--p-----------
ep-rapgqqqelgqepmcl-rvsqwmta-vtvayppdtdtpg-ls-qrdkpqktng-dgis-ffr-cq-dqvakiivrda
k  msn           --vliaeeis-               --p------d-ga er--k--- ad estvrntlmaf
   ---           qcr-------v               nnhlqs lv-q--  a calyd      i        
     s           l gnlvdtvae               gg knp  is d     a iv                
                   d       d               d  i                                 
                   a                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------tiglaylgatdstvrrcmiqr
vqgnfnssvgpdgymlsaltcgmspvtsiteglqqivtvglyrrqrdsvfscswpsikt-faffgivsfslilgaylt-k
a                           v m  frdafme fdsdaevssrs qk f kv-lvgav valalii-f--v-
i                                          qa aaeqdr me   awl a mt l gvv-- -wlal
                                                           l    c       a  lid  
                                                                             a  
                                                                                

       410
....:....|
          
----------
eqskaankre
rl        
l         
          
          
          
© 1998-2021Legal notice