Dataset for protein BCL-2-like of organism Naja naja

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C6V6T2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Naja naja GN=BCL2L1 (length=355 residues).
MTRRISQCLERFACLPASSTFSTFAPPRTAPSAEISSPCLKPTNCSFSRAPFPGRLVPVAGTGRGFHASPAPFLECDSPD
DSSPSFRAWRWDGRARSGRAPRPPTVSRTAEAADHGLTETGRGVKMSSGNRSLVVDFIAYKLAQRGHSWREIQGDSEERT
ELSGEMGSGVLNGGSPSWHPSPSPVVNGAAGIHPALLEELGDGPQAAVRQTLREAGDEFELRYRRAFSDLTSQLHITPGT
AYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMHGLVERIATWMATYLTEHLDPWIQDNGGWERFVDLYGND
AAAKSRKGQERFNKWLWTGATVAGVVLLGSLLSRK
>gnl|bcl2dbpro|A0A8C6VLE3_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Naja naja GN=MCL-1 (length=359 residues).
RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLRRLPGLAPAAPQSPGGGGGGSGEGGLALLPGGVRGGLGGG
LCWPPAGCAEGPRALIGGGPRAGPLSLIGTRDAAARALIGQASAATTPEEELDGCEPEAETGAESSAASSSSSSPAPPGE
AGDPLRQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQGLLGRFGPCPAEAETAARALETLRRVCDDIMEKHQLAFQGM
LRKVQIDKADDLKLMSEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHNA
WEGFVKFFHVEDLEGSIRNILVAFASVAGLGASLAYLIR
>gnl|bcl2dbpro|A0A8C6VLE3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Naja naja GN=MCL-1 (length=359 residues).
RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLRRLPGLAPAAPQSPGGGGGGSGEGGLALLPGGVRGGLGGG
LCWPPAGCAEGPRALIGGGPRAGPLSLIGTRDAAARALIGQASAATTPEEELDGCEPEAETGAESSAASSSSSSPAPPGE
AGDPLRQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQGLLGRFGPCPAEAETAARALETLRRVCDDIMEKHQLAFQGM
LRKVQIDKADDLKLMSEVATQVFNDGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREWLLHHNA
WTGSIKLQKRKGTFCMPEKKKTFKKKRKASGDDWDPPKS
>gnl|bcl2dbpro|A0A8C6VPU0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Naja naja GN=BCL2A1 (length=173 residues).
MESYNFLYVNTLVQDYLKYICQEAQLAAAPNKVAEVLRKAGYSAQKEVESNLRPYMDSLGIHSVEEAGNIFNQVMENEFA
DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFVTDYIVSTKGKWISENGGWDNGFITKFEDRSSWVSLSTLKTK
ILAVFSIFNQYHS
© 1998-2022Legal notice