Dataset for protein BCL-2-like of organism Naja naja

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6VPU0_BCL2A1-      --------MESYNFLYVNT-------------------------------
A0A8C6V6T2_BCL2L1-      MTRRISQCLERFACLPASSTFSTFAPPRTAPSAEISSPCLKPTNCSFSRA
A0A8C6VLE3_MCL1-02      --------RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLR-
A0A8C6VLE3_MCL1-01      --------RHRAGAFITGAPGARHSPPQNQAVLEAGRHVQQEDDGSVLR-
                                      : ..:                               

A0A8C6VPU0_BCL2A1-      --------------------------------------------------
A0A8C6V6T2_BCL2L1-      PFPGRLVPVA-----GTGRGFHASPAPFLECDSPDDSSPSFRAWRWDGRA
A0A8C6VLE3_MCL1-02      RLPG-LAPAAPQSPGGGGGGSGEGGLALLPGGVRGGLGGGL-CWPPAGCA
A0A8C6VLE3_MCL1-01      RLPG-LAPAAPQSPGGGGGGSGEGGLALLPGGVRGGLGGGL-CWPPAGCA
                                                                          

A0A8C6VPU0_BCL2A1-      --------------------------------------------------
A0A8C6V6T2_BCL2L1-      RSGRAPRPPTVSRTAEAADHGLTETGRGVKMSSGNRSLVVDFIAYKLAQR
A0A8C6VLE3_MCL1-02      EGPRA------------------------LIGGGPRAGPLSLIGTRDAAA
A0A8C6VLE3_MCL1-01      EGPRA------------------------LIGGGPRAGPLSLIGTRDAAA
                                                                          

A0A8C6VPU0_BCL2A1-      --------------------------------------------------
A0A8C6V6T2_BCL2L1-      GHSWREIQGDSEERTELSG---EMGSGVLNGGSPSWHPSPSPV-------
A0A8C6VLE3_MCL1-02      RALIGQASAATTPEEELDGCEPEAETGAESSAASSSSSSPAPPGEAGDPL
A0A8C6VLE3_MCL1-01      RALIGQASAATTPEEELDGCEPEAETGAESSAASSSSSSPAPPGEAGDPL
                                                                          

A0A8C6VPU0_BCL2A1-      -------------------------------LVQDYLKYICQEAQLAAAP
A0A8C6V6T2_BCL2L1-      -------------------------VNGAAGIHPALLEELGDGPQAA---
A0A8C6VLE3_MCL1-02      RQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQGLLGRFGPCPAEAETA
A0A8C6VLE3_MCL1-01      RQVTLQLVASYLREAADQEPPKQDDCGGGGKFLQGLLGRFGPCPAEAETA
                                                       :    *  :   .  *   

A0A8C6VPU0_BCL2A1-      NKVAEVLRKAGYSAQKEVESNLRPYMDSLGIHSVEEAGNIFNQVMENEFA
A0A8C6V6T2_BCL2L1-      --VRQTLREAGDEFELRYRRAFSDLTSQLHITPGTAY-QSFEQVVNELFR
A0A8C6VLE3_MCL1-02      ARALETLRRVCDDIMEKHQLAFQGMLRKVQIDKADDL-KLMSEVATQVFN
A0A8C6VLE3_MCL1-01      ARALETLRRVCDDIMEKHQLAFQGMLRKVQIDKADDL-KLMSEVATQVFN
                          . :.** .  .        :     .: *       : :.:*  : * 

A0A8C6VPU0_BCL2A1-      DGKINWGRILTIFLFGGILAKKLQGPLAKENLKQISYFVTDYIVSTKGKW
A0A8C6V6T2_BCL2L1-      DGV-NWGRIVAFFSFGGALCVESVDKEMHGLVERIATWMATYLTEHLDPW
A0A8C6VLE3_MCL1-02      DGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREW
A0A8C6VLE3_MCL1-01      DGITNWGRIVTLISFGAFVAKHLKSINQESGISTLAEIITEVLVTEKREW
                        **  *****:::: **. :.    .      :. ::  ::  :.     *

A0A8C6VPU0_BCL2A1-      ISENGGWDNGFITKFEDRSSWVSLSTLKTKILAVFSIFNQYHS-------
A0A8C6V6T2_BCL2L1-      IQDNGGWER--FVDLYGNDAAAKSRKGQERFNKWLWTGATVAGVVLLGSL
A0A8C6VLE3_MCL1-02      LLHHNAWEG--FVKF------FHVEDLEGSIRNILVAFASVAGLGASLAY
A0A8C6VLE3_MCL1-01      LLHHNAWTG--SIKLQKRKGTFCMPEKKKTFKKKRKASGDDWDPPKS---
                        :  :..*      .:            :  :           .       

A0A8C6VPU0_BCL2A1-      ----
A0A8C6V6T2_BCL2L1-      LSRK
A0A8C6VLE3_MCL1-02      LIR-
A0A8C6VLE3_MCL1-01      ----
                            

© 1998-2022Legal notice