Dataset for protein BCL-2-like of organism Naja naja

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              : ..:                                                             
--------rhragalitgapgarhsppqnqavleagrhvqqeddgsvlr-rlpg-lapaa-----gggggsgegglallp
mtrrisqcmesynffyvst------------------------------a----r-----pqspg---------------
        l  fac panstfstfa  rtapsa isspclkptnc fs  pf    v v       t r fhaspapf e
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ggvrgglgggl-cwppagcaegpra------------------------ligggpragplsligtrdaaaraligqasaa
-----------r-------------prpptvsrtaeaadhgltetgrgv-------------------------------
cdspddsspsf a rwd r rsg                          kmss n slvvdf aykl qrghswreiqgd
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       :    *  :
ttpeeeldg---eaetgaessaasssssspapp--------------------------------cggggkflqglLgrf
---------cep---------------------geagdplrqvtlqlvasylreaadqeppkqdd------lvpdy kyl
seert  s     mgs vlnggsp whp  s v                                vn aagih a  eei
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .  *     . :.** .  .        :     .: *       : :.:*  : * **  *****:::: **. :.
gpcpqeAetaarvletLRrvgddimekhqlafqgmlrkvqIdkaddl-klmsqVatqvFnDGitNWGRIvtlisFGgfva
cqgaal -----arqv  kacysfqlryrsnlspytsslh tsvteygqsfne vnnl r  v-     laifl  ailc
 de  a aapnk a    e   eaekever  rdlmdq g hpgeaa ni e  meee a  ki       f     a  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .      :. ::  ::  :.     *:  :..*      .:            :  :           .       
khlksinqesgistlaeiiteylvtekreWllhnngWeg--fvkl--r---fsvstlkttirkwlwafatvag---s---
vksvgplmkgnvkrisywvatvitstlgp isehga trgfstdfyk-sswvksrkkqksfnnvrvtsnsywsvvl-lsy
 e qdkeahelleq  tf  eh dk  qd    dn  ii  qgnkgtahmpegegr lakfsiggqdhdppklgal
                                             ed daa cled  ek k i k   d   lga    

    
....
    
----
lsrk
 i  
    
© 1998-2022Legal notice