Dataset for protein BCL-2-like of organism Moschus moschiferus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C6CUC2_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C6CUJ2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Moschus moschiferus GN=BCL-2 (length=228 residues).
MAHAAGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGTLSAAPGRAPAPARTSPPPPAAAAGPAPSPVPP
VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVD
SIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C6DX24_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C6E5E6_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Moschus moschiferus GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6E5E6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Moschus moschiferus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLVAGKEAAARREVGGGEAGTVIGGSAGPSPPATLGPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPPVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C6FJ57_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L10 (length=185 residues).
MVDPFRERTARLLLDYLEFCAREPGAPAPAPSTPEAAVLRHVAARVQEANRNVLPLYRRYRRHRVELVARMAQRLLDEDP
GPSWGRVASLVTFAGSLLERPPQTTRRLEKRDDGGVSRDCRLLVALLCAQFCERHRAWLLANGGWDGFCLSFSHSLQPSW
ERQLVWFFFSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A8C6FN58_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2L1 (length=245 residues).
MSQSNWELVVDFLSYKLSQKGYIWSQFSDMEENRTETTEGTESDMETLKAINGNPSWHLADSPAVKGATGHSRSLDARKM
IPVTTVKQALGQASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQVINELLRDGVSWSRIVAFFSFGGALCMKSIDKEMQ
VLVSQVTTWMATYLNDHLEPWIQENGDWDTFVELYENNTATESQKGQERFSCWSLMDMTVWYGSAGLAFQLIITIPFVIV
IQILY
>gnl|bcl2dbpro|A0A8C6MJ03_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Moschus moschiferus GN=BCL2A1 (length=206 residues).
MFRQAPQACASDCLGQLQVSRLKTLLPSKEKMTETEFGYVHRLAEDYLKYVLQIQQTGSRPSKTSRVLQDVASSVQNEVE
RTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGVVNWGRIVTIFAFEGILIKKLQGKCIAPDMDMCKDISYFVAEFITEN
TGEWIRQNGGWENGFVKKFEIKSGWLTFLEVTGKICETLCRLKQYY
© 1998-2022Legal notice