Dataset for protein BCL-2-like of organism Moschus moschiferus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------nrelv-dflsyklsqkgyi--------en-yetgagtgsgsgtss-------------------------
mmmvqamsqs-----v---mfgakrna--wsqfsdvg--rtcgpe-leqdpeal-ainrllvagkeaaarrevgggeagt
 ahtpptrydtwrilmqyvvsr rtrlvs d    melkl--a-- ----ma-dypgg                      
  frdgsqprasdc lklqh c  ep pe       kgdmgv-tp yvpr--e-p ap                      
  aaa pgec aa  g  ig     l          a  a acef pahal  pk                         
      faa      a   e                          a e                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
viggsagpsppatlgpdarrvarpspigaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplg
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------lkdspp--gagatsrkl-----
krppvrplpllvgeasnnspgsdgslpstpppaeeeedelyrqsleiisqylgnpswha-----vgastghpssadarvv
                                                    rrqatg-ayakalq--a-----tpvppm
                                                     llpap rtvlqppqt-sr atse akl
                                                     ea         in p pg  pp   e 
                                                                 k    a         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .             .:                         .*.*:.::. * . :        
------lqalrragdefqrryrrtfsdllsqlhitpgdayqs-fsqvmvelfrdg-vnWgRivaffsFggal-------c
ipvtavketmqqvvsgvelnhetarqgmtrkmdvknetdvkriler-vnhv-s--vts s vatliv eafvlerppqta
vhmatr---anensnslytevqqhlvecvarfaqvsvstrrt --- -e--l-g  p    l sivt a vm       t
r l   vrv gd alp sn f  d kq sd   lrll eqpg  tt s-ke q             e   s        i
      s e  a   d         a  a       f  dg   n  id   e             a   i         
      h                                a    a                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :   :   :      *:  . .*   *   :                                
kesvskemep---lvsqlaewmttylnrhlrdWiqknggWd-gFvelygv--l-------egfwrwvltamtg-------
vklknrnqqvvsrciepivtsiaeviveskep lveqrd ent tlffhnnd-tesrrgqvrgswsswlvlavwygsagl
rh qdidissdmdmcrsvtylvvdqftdrtha  rss   a e cks e-eaapswqkqlkwnilnfrmgfls       
mr ik cdgg   d kr slflcaf etnhge  lq      a  ak sistqepam prfs nfty kdtik       
a  eg   a      gl qa      c   a   hd             hgl a  e l  d fcl  e igi       
               dd                  a             d              a               

       410       420   
....:....|....:....|...
                       
-----a--ga----glyy-ik--
afqlv-gv--vvtl-ilfl--ls
    ivtlptlivvqaalwsr  
    liliagccriksf sr   
    ace  f  l  q  gh   
      a           a    
© 1998-2023Legal notice