Dataset for protein BCL-2-like of organism Moschus moschiferus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  :                                             
--------------------------asspsnrelvvdflsyklsqkgy-------------------------------
mfglkrnaviglnlycggaglgqgsg-mvqrtwlila-ye----re---geagtviggsagpsppatlgpdarrvarpsp
  rqapq         asdc mmmvpptryggkt --sk-kmtr--v g                               
                      ahtdlqgsdlar  pk-vhfcet r a                               
                       aaagfae   a  mg igaaa  p                                 
                                    l   e     f                                 
                                        a                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
igaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrppvrplpllvwsqfsdvegnrtea
                                                                 sgeasnnspesdgst
                                                                 i d    ma da al
                                                                 e              
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .             .:     
-----------------------------atgakpa-p-agsgitvtkvlqalrragdefqrryrrtfsdllsqlhitpg
pegtesdmetlsaingnpswhladspavqgatghs-s-l-revapsraaketmqqvvsgvelnhetarqgmtrkmdvkne
tstpppapgepkevyrrapeyisyylrpp-pasgdrkldg----h-a-----anensnslytevqqhlvecvarfaqvsv
 p aa  e  ed lp qsldpartv qinvc pr stspvpvmv-msttvrv gd alp sn f  d kq sd   lrll
             ah l eai kq  pekq   a  p e aplraldprs e  a   d         a  a       f
                                         k p a  lh                              
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .*.*:.::. * . :                         :   :   :      *:  .
dayqs-fsqvmvelfrdg-vnWgRivaffsFggal-------ckesvskemep---lvsqlaewmttylnrhlrdWiqkn
tdvkriler-vnhv-s--vts s vatliv eafvlerppqtavklknrnqqvvsrciepivtsiaeviveskep lveq
strrt --- -e--l-g  p    l sivt a vm       trh qdidissdmdmcrsvtylvvdqftdrtha  rss
 eqpg  tt s-ke q             e   s        imr ik cdgg   d kr slflcaf etnhge  lq 
  dg   n  id   e             a   i         a  eg   a      gl qa      c   a   hd 
  a    a                                                  dd                  a 
                                                                                

       330       340       350       360       370       380      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
 .*   *   :                      :                                
ggWd-gFvelygvndl-es-r--egfirwvltaltg---------------ga----glyy-ik--
rd ent tlffhneaaw--r-gqvrgscsswlvmavwygsaglafqlvagv--vvtl-ilfl--ls
   a e cks e----tswqkqltwnwwnyrmrf--           lvtlpglivvqaalwsr  
     a  ak sistqpptmlpvfdknflt kgils           iiliafc liksf sr   
            hksgelaf lr   faef cd ii           a a        q  gh   
            dgl a  e e                                       a    
                                                                  
© 1998-2022Legal notice